KEGG   Zea mays (maize): 100273457
Entry
100273457         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100273457
  KO
K23134  dolabradiene monooxygenase / zealexin A1 synthase [EC:1.14.14.159 1.14.14.160]
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:zma00199]
    100273457
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.159  dolabradiene monooxygenase
     100273457
    1.14.14.160  zealexin A1 synthase
     100273457
Cytochrome P450 [BR:zma00199]
 Cytochrome P450, plant type
  CYP71 family
   100273457
SSDB
Motif
Pfam: p450 GlutR_dimer
Other DBs
NCBI-GeneID: 100273457
NCBI-ProteinID: NP_001141366
UniProt: B4FVP3
Position
5
AA seq 505 aa
MEDKVLIAVGTVAVVAVLSKLKSAVTKPKLNLPPGPWTLPLIGSIHHIVSNPLPYRAMRE
LAHKHGPLMMLWLGEVPTLVVSSPEAAQAITKTHDVSFADRHINSTVDILTFNGMDMVFG
SYGEQWRQLRKLSVLELLSAARVQSFQRIREEEVARFMRSLAASASAGATVDLSKMISSF
INDTFVRESIGSRCKYQDEYLAALDTAIRVAAELSVGNIFPSSRVLQSLSTARRKAIASR
DEMARILGQIIRETKESMDQGDKTSNESMISVLLRLQKDAGLPIELTDNVVMALMFDLFG
AGSDTSSTTLTWCMTELVRYPATMAKAQAEVREAFKGKTTITEDDLSTANLRYLKLVVKE
ALRLHCPVPLLLPRKCREACQVMGYDIPKGTCVFVNVWAICRDPRYWEDAEEFKPERFEN
SNLDYKGTYYEYLPFGSGRRMCPGANLGVANLELALASLLYHFDWKLPSGQEPKDVDVWE
AAGLVAKKNIGLVLHPVSHIAPVNA
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggaggacaaggtgctcatcgccgtgggaacggtggcggtggtcgccgtcctctccaag
ctcaagtcggccgtgaccaagccgaagctgaaccttcctccagggccatggacgctgccg
ttgattggcagcatccaccacatcgtcagcaacccgctgccctaccgggcgatgcgcgag
ctcgcgcacaagcacgggccgctcatgatgctgtggctgggcgaggtgcccacgctggtg
gtgtcgtcgccggaggccgcgcaggcgatcaccaagacgcacgacgtgtcgttcgccgac
cgtcacatcaacagcaccgtcgacatactcaccttcaacggcatggacatggttttcggg
tcctacggcgagcagtggcggcagctccgcaagctcagcgtgctggagctgctgagcgcc
gcgcgggtgcagtcgttccagcgcatccgcgaggaggaggtggcgcggttcatgcggagc
ctcgccgcgtccgccagcgccggcgccaccgtcgacctgtccaagatgatctcaagcttc
atcaacgacaccttcgtcagggagtccatcggcagccggtgcaagtatcaggacgagtac
ctggctgccctggacactgccattcgggtggccgcggagctaagcgtaggtaacatcttc
ccgtcgtctagggtgttgcagagtcttagcacggcgcgacgcaaggcgatagcgtcccgc
gacgagatggcgcgcatcctcgggcagatcatccgcgagaccaaggaatccatggatcag
ggtgacaagacttcaaacgagagcatgatctccgtcctgctcaggcttcagaaagacgcc
ggcttgcccatcgagctcaccgacaacgtcgtcatggcgctcatgtttgacttgtttggc
gcgggcagcgacacctcgtcgacaacgctgacctggtgcatgacagagctggtccggtac
ccggcaacgatggccaaagcgcaggccgaggtccgggaggctttcaaggggaagaccacg
atcacggaggacgacctgtccacggcaaatcttaggtacctgaagctcgtggtgaaggaa
gcgctcaggttgcactgcccggtgccgctcctgctcccacgcaaatgccgggaggcgtgc
caggtcatgggctacgacatccctaaaggcacatgcgtgttcgtcaatgtctgggcgatc
tgtagggaccctaggtactgggaagacgccgaggaattcaagccggagcggttcgagaac
tccaacctagactacaagggaacatactacgagtacctcccgttcgggtctggccgtcgc
atgtgcccgggagcaaaccttggagtggccaacttggagcttgcactggccagccttctg
taccatttcgattggaagctaccaagtggacaggagcctaaggatgtcgatgtctgggag
gctgcaggactggttgcgaagaaaaacataggcctggttctgcaccctgtcagccacatt
gctccggttaatgcctaa

DBGET integrated database retrieval system