KEGG   Zea mays (maize): 103628119
Entry
103628119         CDS       T01088                                 

Definition
(RefSeq) ent-isokaurene C2-hydroxylase
  KO
K23134  dolabradiene monooxygenase / zealexin A1 synthase [EC:1.14.14.159 1.14.14.160]
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:zma00199]
    103628119
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.159  dolabradiene monooxygenase
     103628119
    1.14.14.160  zealexin A1 synthase
     103628119
Cytochrome P450 [BR:zma00199]
 Cytochrome P450, plant type
  CYP71 family
   103628119
SSDB
Motif
Pfam: p450 SelB-wing_1 GlutR_dimer
Other DBs
NCBI-GeneID: 103628119
NCBI-ProteinID: XP_020393230
Position
5
AA seq 506 aa
MEDKVLLAVAMVALIAVLSKLKSLLETKPKLNLPPGPWTLPLIGSIHHLVSSPLPYRAMR
ELAHKHGPLMMLWLGEVPTLVVSSPEAAQAITKTHDVTFADRHMNSTVDILTFNGNDIVF
GTYGEQWRQLRKLSVLELLSVARVQSFQRIREEEVARFMRNLAASAGAGATVDLSKMISS
FINDTFVRESIGSRCKHQDEYLDALHTGIRVAAELSVANLFPSSRLLQSLSTARRKAVAA
RDEMARILGQIIRETKEAMDWGDKASNESMISVLLRLQKEAGLPIELTDDIVMALMFDLF
GAGSDTSSTTLTWCMTEMIRYPATMAKAQAEVREAFKGKTTITEDDLSRANLSYLKLVVK
EALRLHCPVPLLIPRKCRETCQIMGYDIPKDTCVLVNVWAICRDSRYWEDADEFKPERFE
NSSLDYKGTSHEYLPFGSGRRMCPGGNLGVANMELALASLLYHFDWKLPSGQEPKDVDVW
EAAGLVGRKNAGLVLHPVSRFAPVNA
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggaggacaaggtgctcctcgccgtggccatggtggcgctgatcgccgtcctctccaag
ctcaagtcgttgctcgagaccaagccgaagctgaacctgcccccagggccatggacgctg
ccattgatcggcagcatccaccacctcgtcagcagcccgctgccctaccgagcgatgcgc
gagctcgcacacaagcacgggccgctcatgatgctgtggctgggcgaggtgcccacgctg
gtggtgtcgtcgccggaggccgcgcaggcgatcaccaagacgcacgacgtcacgttcgcc
gaccgtcacatgaacagcaccgtcgacatactcaccttcaacggcaatgacatagtgttc
gggacgtacggcgagcagtggcgccagctccgtaagctcagcgtgctggagctgctgagc
gtggcgcgggtgcagtcgttccagcgcatccgcgaggaggaggtggcgcggttcatgcgg
aacctggccgcgtccgccggcgccggtgccaccgtcgacctgtcgaagatgatatctagc
ttcatcaacgacaccttcgtcagggagtccatcggcagccggtgcaagcatcaggacgag
tacctggatgcactgcacactggcattcgggtggccgcggagctaagcgtagctaacctc
ttcccgtcgtctaggctgttgcagagtcttagcacggcgcgacgcaaggcggtagcggcc
cgcgacgagatggcgcgcatcctcgggcagatcatccgcgagaccaaggaagccatggac
tggggtgacaaggcttcaaacgagagcatgatctccgtcctgctgaggctgcagaaagag
gccggcttgcccatcgagcttacggacgacatcgtcatggcgctcatgtttgacttgttt
ggcgcgggcagcgacacctcgtcgacaacgctaacctggtgcatgacagagatgatccgg
tacccggccacgatggccaaagcgcaggccgaggtccgggaggccttcaaggggaagacc
acaatcacggaagacgacctgtccagggcaaaccttagctacctcaagctcgtggtgaag
gaagcgctcaggttgcactgcccggtgccgctcctgatcccacgcaaatgccgcgagaca
tgccagatcatgggctacgacatccctaaagacacatgcgtgctcgtcaatgtctgggcc
atctgtagggactctaggtactgggaagatgccgacgaattcaagccggagcggttcgag
aactccagcctagactacaaagggacaagccacgagtacctcccgttcgggtctggccgt
cgaatgtgcccaggagggaaccttggagtggccaacatggagcttgcactagccagcctt
ctgtaccatttcgattggaagctaccaagtggacaggagcccaaggatgtggatgtttgg
gaggctgcaggactggttggaaggaaaaacgcaggcctggttttgcacccggtcagccgc
tttgctccggttaatgcctaa

DBGET integrated database retrieval system