KEGG   Zea mays (maize): 103641226
Entry
103641226         CDS       T01088                                 
Name
(RefSeq) uncharacterized protein LOC103641226
Organism
zma  Zea mays (maize)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth RE_Bpu10I
Other DBs
NCBI-GeneID: 103641226
NCBI-ProteinID: NP_001288477
UniProt: Q6JD72
Position
10:complement(75321191..75324410)
AA seq 554 aa
MASPPAHRSSKAADEELPKVSSTFHPSLWGSFFLTYQPPTAPQRANMKERAEVLRERVRK
VLKGSTTDQLPETVNLILTLQRLGLGYYYENEIDKLLHQIYSNSDYNVKDLNLVSQRFYL
LRKNGYDVPSDVFLSFKTEEGGFACAAADTRSLLSLYNAAYLWKHGEEVLDEAISSTRLR
LQDLLGRLLPESPFAKEVSSSLRTPLFRRVGILEARNYIPIYETEATRNEAVLELAKLNF
NLQQLDFCEELKHCSAWWNEMIAKSKLTFVRDRIVEEYFWMNGACYDPPYSLSRIILTKI
TGLITIIDDMFDTHGTTEDCMKFAEAFGRWDESAIHLLPEYMKDFYILMLETFQSFEDAL
GPEKSYRVLYLKQAMERLVELYTKEIKWRDEDYVATMSEHLKVSAESIGANALTCSAYAG
MGDMSITKETFEWALSFPQFIRTFGSFVRLSNDVESTKREQTKDHSPSTVHCYMKEHGIT
MDDACEKIKELIEDSWKDMLEQSLALKGLPKVVPQLVFDFSRTTDNMYRDRDALTSSEAL
KEMIQLLFVEPIPE
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggcgtctcctccagcacatcgttccagcaaggcagctgatgaggagctgccaaaggtt
tcttcgaccttccacccaagcctgtggggcagtttcttcctgacctaccagccgccaact
gcaccccagcgagcaaacatgaaagaacgagctgaggttttaagagaacgtgttaggaag
gttttgaagggctcgacgactgatcaactaccagaaacagtgaatcttatattaacattg
caaagacttggactgggttactactacgagaacgagatagacaagttgctgcaccaaatt
tacagcaactccgattacaatgtgaaagatcttaacttggtttcgcagcggttctacctt
cttcgaaagaacggctacgatgtgccatcagatgtatttctgagcttcaaaacagaagaa
ggcggcttcgcctgtgctgctgctgacacgagaagcttgttaagcttatataacgcagca
tatctgtggaagcatggagaggaggtactggacgaagcgatttcatcgactagactccgc
ctccaagatctccttggacgacttcttccagaatcgccatttgcaaaggaggtgtcttct
tcccttcgtacccctctcttcagaagggttgggatactagaagcgagaaactacataccc
atttacgaaacggaggcgacgcgaaacgaagccgtattggagcttgcgaaactgaatttt
aaccttcagcaacttgatttctgtgaagagctaaagcattgctcagcgtggtggaacgag
atgatagccaaatcaaagctgacctttgttagagatagaattgtagaggagtatttctgg
atgaatggagcatgctatgatccgccatactccctttcccgaattatactgacaaagatc
acgggacttattacaataatcgatgatatgtttgatacacatggtaccactgaagattgc
atgaaattcgctgaagcgtttggcagatgggacgaaagtgcaatacatctccttccagag
tacatgaaggatttctacatattgatgttggagacatttcagtcatttgaggatgcttta
gggccagagaagagctaccgtgtgctctacctaaaacaggcgatggagcgtttagttgag
ctatacaccaaggaaataaaatggcgtgatgaggattatgtggcgacaatgagtgaacac
ctcaaggtttcagcagagtccatcggagccaatgctctaacatgttctgcatatgctggg
atgggtgatatgtcgataacaaaggagaccttcgagtgggctttgagctttccacaattt
ataagaacttttggttcatttgtacggctctccaacgatgtcgaatcgaccaagcgtgag
caaacaaaagaccatagtccgtccactgtccattgttacatgaaggagcatggaataaca
atggatgatgcatgtgaaaagataaaagagcttatcgaagattcatggaaggatatgctg
gagcaatcccttgcgctgaaagggctcccaaaggttgtgccacagctagtgtttgacttc
tcaagaaccacggataatatgtacagggatcgtgacgcattgacttcttcagaagcactc
aaggaaatgatacagctactgtttgtggagccaatacccgaatga

DBGET integrated database retrieval system