KEGG   Zea mays (maize): 103642652
Entry
103642652         CDS       T01088                                 

Name
(RefSeq) cytochrome P450 93G1
  KO
K23180  flavone synthase II [EC:1.14.19.76]
Organism
zma  Zea mays (maize)
Pathway
zma00941  Flavonoid biosynthesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    103642652
   00943 Isoflavonoid biosynthesis
    103642652
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:zma00199]
    103642652
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.76  flavone synthase II
     103642652
Cytochrome P450 [BR:zma00199]
 Cytochrome P450, plant type
  CYP93 family
   103642652
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 103642652
NCBI-ProteinID: XP_008664095
Position
10:complement(97908767..97910855)
AA seq 553 aa
MAGGYARIYMRLLKNRGGYVAMEEQQLRARPNMMVLSSLAKNNPEAVLALIAFVTVVALR
HLISSWRQHGRLPPGPTSLPVIGHLHLLRPPVHRTLQELASRIGPLMHIRLGSTNCVVAS
SPEVASELIRGHEGSISARPFTAVARKFSYDSAGFVFEPYNTHWRFMKRLCMSELLGPRT
VEQLRPVRRAVTVSLVSDLLASSARGETVDITRHLIRLTNTSIIRMVASTVSGSVTDEAH
ELAKAVIEVVGAFNVDDYIAVVRGWDFQGLGRKAADVHRRFDALLEDILRHKEEARAARR
LDDGHGKQATHSKDLLDILMDKAEDPAAEVKLTRENIKAFVIDVVTSGSDTSAAMAEWML
AELMNHPETLRKVVEEIDAVVGGGRIASEADLPQLPYLMAVYKETLRLHPAGPIAHRQST
EEMVVHGFTVPPQSTVLIHVWAIGRDPAYWEEPLLFRPERFMPGGAAESLEPRGKHFQYI
PFGSGRRGCPGMGLAMQSVPAVVAALVQCFYWATVDGGVDKIDMSESDGLVCARKKPLLL
RPTSRLTPFPPVV
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggccggcggctatgcgcgaatttatatgaggcttttaaagaatagaggagggtacgta
gccatggaagagcagcagctccgcgcccgcccaaacatgatggtcctgtcgtcgctcgcc
aagaataacccagaggccgtcctggcgctcatcgcgttcgtcaccgtcgtcgccctgcgc
cacttgatctcttcatggcggcagcacggccggctgcccccggggccgacgagccttccg
gtgatcggacacctgcacctgctccgcccgccggtgcaccgcaccttgcaggagctggcg
tcccggatcggtcccctgatgcacatccgccttggctccacaaactgcgtggtggccagc
agcccagaggtggccagcgagctcatccgcggccacgagggcagcatctcggcgcggccg
tttacggcagtggcccgcaagttctcctacgactccgccggcttcgtcttcgagccctac
aacacgcactggcgcttcatgaagcgcctctgcatgtcggagctactcggcccacgcacc
gtcgagcagctgcgccccgtccgccgcgctgtcaccgtgtccctggtctccgacctgctg
gcgtcgtcggcgcgcggggagacggtggacatcacccgccatctcatccgcctcacaaac
acctccatcatccggatggtggccagcaccgtgtccggcagcgtcaccgacgaggcgcac
gagctggccaaggccgtaattgaggtcgtgggcgccttcaacgtcgacgactacatcgcc
gtggtccgtggctgggatttccagggcctcggcagaaaagccgccgacgtccaccgccgc
ttcgacgcgctgctggaggacatcctgaggcacaaggaggaggcgagggcagcgcgaagg
ctcgacgacggacatggcaagcaggccacgcacagcaaggacctgctcgacatcctcatg
gacaaggcggaggacccggcggcggaggtcaagctcacccgggaaaacatcaaggcgttc
gtcatcgacgtggtgacgtctggttcagacacgtcggcggccatggcagagtggatgctg
gcggagctgatgaaccacccggagacgctgcgcaaggtggtagaggagatcgacgctgtg
gtcggcggcggcaggatcgccagcgaggcggacctgccgcagctgccgtacctgatggcg
gtatacaaggagacgctgcgtctgcacccggcggggcccatcgcgcaccggcagtcgacg
gaggagatggtggtacacggtttcaccgtgccgccgcagtcgacggtgcttatccacgtg
tgggccatcggacgcgacccggcctactgggaggagcccctgttattccggccggaacgg
ttcatgccaggcggcgctgccgagagcctggagccccgcgggaagcacttccaatacatt
cccttcggcagcggccgtcggggatgtcccggcatgggcctcgcgatgcagtcagtgccg
gccgtggtagcggcactcgtgcagtgcttttattgggccaccgtcgacggcggggtggac
aagatcgacatgtcggagtcggacgggctggtgtgtgctcgtaagaagccacttctgctc
cgacccacatctcgcctcacccccttcccgcccgtcgtatag

DBGET integrated database retrieval system