KEGG   Zea mays (maize): 109944638
Entry
109944638         CDS       T01088                                 

Definition
(RefSeq) cytochrome P450 93G2
  KO
K23135  flavanone 2-hydroxylase [EC:1.14.14.162]
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:zma00199]
    109944638
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.162  flavanone 2-hydroxylase
     109944638
Cytochrome P450 [BR:zma00199]
 Cytochrome P450, plant type
  CYP93 family
   109944638
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 109944638
NCBI-ProteinID: XP_020404992
Position
2
AA seq 516 aa
MEAAAAVTPLALLLLLLLVTRWRWSSSRNSKLPPSPMALPLIGHLHLIRRLPHRSLDRIL
ARYGPLVYLRLGPSTHCIVAGTADAARDLLKHEASIPQRPLTVVARHLAYDDAGFAFAPY
GAHWRFMKRLCMSELLGPRTVDQLRPVREAELAAVLGAAASASASGEGEPIDVSRHLISM
SNNAIMRMVASALPGHMTEAARDCAKHVAELVGAFNIEDYVGLCRGWDLQGLTRRTRQVR
DKFDALLEMMITAKEEKRRRRQQGQGDHHDLLDILMDAAADENAEVRLTRENIKAFVLDI
FTAGSDTTATSVEWMLAYLINHPACMDKLRAELDGVVGASRLVGEQDVPHLPYLQAVFKE
TLRLQPPAVFAQRETVDTVRVRGYVIPPKTSVIFNVFSIGRDPGWWEDPLQFRPERFMPG
GAGAGIDPKGQHMQLIPFGSGRRACPGMGLAMQAVPAFLAALVQCFHWAVPIQQGQSKAP
PLDMEEAPGLVTARKHPLLLIPTPRLNPLPLQATAT
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggaagcagcagctgctgtcactcccctggccctgctgctcctcctcctcctcgtcacc
agatggagatggagtagtagccgcaacagcaagctgcccccgagccctatggccctcccg
ctcatcggccaccttcacctcatccgccggctgccgcacagatccttggaccgcatcctg
gcgcgctacgggcccctcgtctacctccgcctgggcccctccacgcactgcatcgtcgcc
ggcaccgcggacgccgcccgggacctcctcaagcacgaggccagcatcccgcagcggccg
ctcacggtcgtggcacgccacctcgcctacgacgacgccggcttcgccttcgctccctac
ggcgcgcactggcgcttcatgaagcgcctgtgcatgtccgagttgctgggaccgcgcacc
gtcgaccagctgcgccccgtgcgggaggccgagctggcggccgtgctgggggcggccgcc
agcgccagcgccagtggggagggggagcccatcgacgtcagccgccacctcatcagcatg
tccaacaacgccatcatgcgcatggtggccagcgcgctgccgggccacatgacggaagcg
gccagggactgcgccaagcacgtagcagagctcgtgggggccttcaacatcgaggactac
gtcggcctctgccggggctgggacctgcaggggctcacgcggaggacgcgccaggtgcga
gacaagttcgacgcgctgctggagatgatgatcacggccaaggaggagaagcgtcggaga
cggcagcagggacagggagaccaccacgacctgctggacatcctcatggacgcggcggcg
gacgagaacgcggaggtcaggctgaccagggagaacatcaaggccttcgtcctcgacatc
ttcaccgctggctccgacaccaccgccaccagtgtggagtggatgctggcgtacctcatc
aaccacccggcctgcatggacaagctgcgcgcggagctggacggcgtggtgggcgcgtcg
cgcctggtcggggagcaggacgtcccgcacctgccctacctgcaggccgtcttcaaggag
acgctgcggctgcagcctcccgccgtgttcgcgcagcgggagaccgtcgacacggtgcgc
gtccgcggctacgtcatcccgcccaagacctccgtcatcttcaacgtcttctccatcggc
cgcgacccgggctggtgggaggaccccctccagttccggccggagcgtttcatgccgggc
ggcgccggtgcaggcatcgaccccaaggggcagcacatgcagctgataccgttcgggagc
ggccgccgcgcttgcccgggcatgggcctcgccatgcaggccgtgccggccttcctcgcc
gcgctggtgcagtgcttccactgggcggtgcccatccagcagggccaatccaaggcgccg
cctttggacatggaggaagcaccagggctcgtcaccgcccggaagcaccctctcctcctc
atccccacaccgcgcctcaatccgctgccgctgcaggcaacagctacctag

DBGET integrated database retrieval system