KEGG   Zygotorulaspora mrakii: HG535_0C04180
Entry
HG535_0C04180     CDS       T06976                                 

Name
(RefSeq) uncharacterized protein
  KO
K10868  DNA repair protein XRS2
Organism
zmk  Zygotorulaspora mrakii
Pathway
zmk03440  Homologous recombination
zmk03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:zmk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    HG535_0C04180
   03450 Non-homologous end-joining
    HG535_0C04180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:zmk03400]
    HG535_0C04180
DNA repair and recombination proteins [BR:zmk03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     HG535_0C04180
   NHEJ (non-homologous end-joining)
    MRX complex
     HG535_0C04180
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-GeneID: 59235762
NCBI-ProteinID: XP_037143792
Position
3:complement(813612..815876)
AA seq 754 aa
MWILRYQYELDGGNLNSVSFCINSEQINSIGRSSKNNLVIRNDKSISREHLRFSWKRNES
SLNFTNKGKLTAANGKYLKPDETISFEESLYHSLPIVIELGTKPTRIEVRRQEEVWDIPS
DLSNFEPVLKISGIDVISNRKRENTCNLMVASNNVILNRLRHLFALINGIKFVNSEFLTR
ASTILCQKQDNFDDLWSDLRDPKYLMYSDTPAHKKHVSLLGLKFYVLGGDSEEIDLARSS
IEAVGGSVSTCDIAYLEHALQHERSKESIIIIQLSGETSLPTNIEGRTIDQLINAFSKED
VESLLGGISESDSVLKSATLSPTQNNDAQQLSLNDKSSILPMRPLKRRRVTRQTIKPLDS
LMFFAGGDSIVDDSIKNDSQKQISQIPELLNRKSSQIEIPAAEQALTMSEKQPETSCSTH
SSVIEESTKRKRDESSNNKQCEDALQDKRVHTFAVAIGTHENPDLTIAKRGKKSLNTHTL
PKNTRKKTLTDYKIDSNKSGEDETKQDPQDLVQVIQDTKNREVNRLRSTLVQVSADELTD
DAIMKLGNITLVERNDSLYRHDSSKQVSGDKAEKQAFEGRKNFKVFTKSWPAYQQKQLGS
SVSQASSNSVRNSAFLISRKYVPLKEYSKDSEGTNDQEFNDFVDPHVHAEKESSSHSYIV
ENGDQRSFSFSRNSSASNALFVADEDEDPVIPLVQPEKDIPRSSSRSRSRSKSISGHALP
QSKSNMRSRFEMDGDSDDDSDDDGPKFSFKRSRR
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgtggatcttaagataccaatatgagctggatggagggaatctcaatagcgtgtcattt
tgcatcaatagcgagcaaataaactctattggacgctctagtaaaaataatctcgttata
agaaacgacaaaagcatatcaagagagcatcttcggtttagttggaaaaggaacgaatca
tctttgaattttactaataaaggaaaactaacagctgctaatggtaaatatttaaagcct
gacgagaccatcagcttcgaagaatcattgtatcactcactgccaatagtaatagagttg
ggaacaaaaccgacacgaatagaagttcgaagacaagaagaggtttgggatattccatcc
gatctatctaattttgagcctgtattgaaaatcagtggaatagatgtaatttcaaaccgg
aaacgtgagaatacatgcaacttgatggttgctagcaataacgtcatattgaatcggctt
cgacatctctttgcactaataaatggcataaaatttgtgaattctgaattcctaactcgt
gctagcacaatactatgtcaaaaacaggacaactttgatgatttatggtcagatttaaga
gatcctaaatacctgatgtactctgatactcctgcgcataaaaaacatgtcagtcttctc
gggttgaagttttatgtcttgggtggtgatagcgaagaaattgatctcgctagaagttcc
atcgaggcagttggtggcagtgtaagtacctgcgatatcgcatatttggaacatgccttg
cagcacgagcgttcgaaagagagcataataataatccaattaagtggggagacttcatta
cccactaatatagaaggtcgcactattgatcaattgatcaatgctttttcaaaagaagac
gtggagtcactattgggtggcatatcagaatctgactctgtattaaaaagtgcaacttta
agtccaacacagaacaatgatgcccaacagttatcactcaatgataagtcaagtatcctc
cccatgcgccccttgaaaagaagaagggtgactagacagacgatcaaacctctggatagt
ttgatgtttttcgccggtggagatagtattgtagatgattcgataaaaaacgatagtcag
aaacaaattagtcaaattcctgaattgcttaatagaaaatcgtcacaaatcgaaatacct
gcagctgagcaggcattgacgatgagtgaaaaacagccagaaacctcttgttccactcat
tccagtgtgatagaagagagtactaagcgaaaaagagatgaatcatctaacaataaacag
tgtgaagatgccctccaagataaacgagtgcacactttcgcagttgcaatcggtactcat
gagaatcccgacctcaccattgcaaagaggggcaaaaaatcactaaatacacacacattg
ccaaaaaatactaggaaaaagacattaactgattacaaaatcgatagcaataagtctggt
gaagatgaaacaaagcaggatcctcaagatttagttcaggtgattcaagatactaaaaat
cgtgaagtaaacaggctgaggtcgactttggtacaagtatctgcggatgaactgactgat
gatgccattatgaaacttggaaatatcactcttgtagagcgcaatgactcactttatcgc
catgactctagcaaacaagtttcaggagataaggcagaaaaacaagcgtttgaaggtcga
aaaaatttcaaagtgttcaccaaatcctggcctgcataccagcagaaacagctcggtagc
tcagtaagtcaggcatcctcgaactccgtaagaaatagcgcctttctcatatcaagaaaa
tatgttccacttaaagagtatagcaaggactcagagggaaccaacgaccaagagtttaat
gactttgtggaccctcacgttcatgcagaaaaggaatcatcttcacattcgtatattgtt
gaaaatggcgatcagcgctcattcagtttttcacgtaacagtagtgccagtaacgctttg
tttgtagcagatgaagatgaagatccggtcattccactcgtgcaacccgagaaagatatt
cctagatcaagctctaggtcaagatcaagatccaaatctatatcaggtcatgcattgccc
cagtctaaatcaaatatgagaagcagatttgaaatggacggagattcggatgacgattca
gatgacgatggaccaaaattcagcttcaaacgtagtcgacggtaa

DBGET integrated database retrieval system