KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0002
Entry
ZMO0002           CDS       T00221                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00340  Histidine metabolism
zmo00350  Tyrosine metabolism
zmo00360  Phenylalanine metabolism
zmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmo00401  Novobiocin biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ZMO0002
   00350 Tyrosine metabolism
    ZMO0002
   00360 Phenylalanine metabolism
    ZMO0002
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZMO0002
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    ZMO0002
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zmo01007]
    ZMO0002
Enzymes [BR:zmo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     ZMO0002
Amino acid related enzymes [BR:zmo01007]
 Aminotransferase (transaminase)
  Class II
   ZMO0002
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AAV88626
UniProt: Q5NRM8
Position
2538..3653
AA seq 371 aa
MKPLSSINKRQFLSLSALTAFLPMATQVLGKNSGKEASKNLVYANLNENPFPPSPLVKQA
IEAELDQIGRYSESAAAQKLVNQIASLENIDPDQIILGEVLGSLGLFLAGIKPDQGNIVY
SVPGYTALVDAGKPAGLKGIGIALNKALQNDLPALEKAITAETKAVYLVNPHNPSGTVNH
HTDFSEFLARASQKTLIIVDEAYLEYAHFAQTAASFTQKGANVAVFRTLDKIYGLAGMPI
GYLLAPKALAASLREAGLGDPHDLGRLTVAAARAALSDQKRRLFIHDYTVKNRVRLTAAL
DKLKLTHTESESNFVFFKTPIPFSEAREKFYQSGIVVARPFPPLNDWIRLSLGRDEEVSR
IITALNRIFGA
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaagcctttgtccagcatcaataaacggcaatttctttcgctttctgctctgaccgct
tttttaccaatggcaacccaagtcttgggtaaaaattccggtaaagaggcctcgaagaat
ttggtctatgccaatttgaacgagaatccttttccgccatcgcctttggtgaagcaggcg
attgaggctgagctagatcagattgggcgttatagcgaatcagcggcggcgcaaaaattg
gtcaaccagattgctagcctggagaatattgatcccgatcagattattttgggtgaagtg
ttgggtagccttggtctgttcttagccggaataaagcctgatcaggggaatattgtctat
tctgttccgggctatactgccctcgtcgatgccggaaaacctgctggtttgaagggtatt
ggcatagccttgaataaggcgttgcagaatgacctgcctgccttggagaaggccattaca
gcggaaaccaaagcggtctatctagttaatccccataatcccagcggaaccgtcaatcat
cataccgattttagtgaatttttggcgagagcatcgcaaaagacattgattattgtcgat
gaggcctatcttgaatatgcccattttgcccaaaccgcggccagttttacccagaagggt
gccaatgtcgctgtttttcggactttggataaaatttatggtttggccggtatgccgata
ggctatcttttggcaccgaaggccttggcggcttccttgcgggaagcgggtttaggtgat
ccccatgatttgggtcgtttgacggttgccgccgcgagagcggcattatccgatcaaaaa
aggcggttgtttatccatgactatactgtgaaaaatagagtaaggctgaccgctgctttg
gataagttaaagctaacccatacagaaagtgaatccaattttgtgttttttaaaacgccg
attccgttttctgaagcacgagagaaattctatcaatcgggtattgttgtggcgcggcct
ttcccgcctttgaatgactggatccgcttgtctttggggcgtgatgaagaggttagccgt
attattacagcgcttaatcggattttcggggcttaa

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0421
Entry
ZMO0421           CDS       T00221                                 

Definition
(GenBank) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00340  Histidine metabolism
zmo00350  Tyrosine metabolism
zmo00360  Phenylalanine metabolism
zmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmo00401  Novobiocin biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ZMO0421
   00350 Tyrosine metabolism
    ZMO0421
   00360 Phenylalanine metabolism
    ZMO0421
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZMO0421
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    ZMO0421
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zmo01007]
    ZMO0421
Enzymes [BR:zmo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     ZMO0421
Amino acid related enzymes [BR:zmo01007]
 Aminotransferase (transaminase)
  Class II
   ZMO0421
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Alliinase_C
Other DBs
NCBI-ProteinID: AAV89045
UniProt: P34037
Position
complement(421449..422558)
AA seq 369 aa
MTAAPELRPKSWIDSIAPYIPGSSKTLDGRPAVKLSSNENPLGTSLKAKEAYREAIDSLS
LYPDSGATALREAIGACYNLDPARIIHGTGSDEILHLAAGAYAGQDDEVLYPRYSFSVYP
LAARRVGATPVEAPDDDYRCSVDALLKAVTPRTRVVFIANPNNPTGTWITRAEVEKLHNG
LPRNCLLVIDQAYAEYLDPECDDGALALAKNTKNVLVTRTFSKIYGLAAERIGWAYACPE
IIDALNRIRAPFNVTIAGQKAAVAALEDQAFIQNSFKHNKKWRGWFENQMALLSNAGIRV
IPSSANFTLLLFEGSLTAETAYKALMDHGYTTRWLPGQRLPHALRITIGSEKHMQDVAGI
LTSLVRQAL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgactgctgcacctgaacttcgcccgaaatcttggatcgacagtattgcgccttacata
ccggggtcatcaaagacgctggatggccgtccggctgtcaaactttcatctaatgaaaac
cctttgggaaccagcctaaaggcgaaagaagcctatcgggaagccatagactccctttcc
ctgtatcctgacagtggggcaaccgctctgcgtgaggccatcggcgcttgctataatctt
gatccggctcggattattcacggcaccggatcggatgaaatcctgcatttggccgccggt
gcctatgccggacaagatgacgaggttttatatcctcgctatagtttttcagtttacccg
ctggctgccagacgcgtaggcgcaacaccggtagaagcaccagatgatgactatcgttgt
tctgttgatgccttgttaaaggccgtcacgccacggacgcgggttgtctttattgccaat
ccgaataacccgacgggaacatggattacccgtgccgaagtcgaaaaactgcataacggc
cttccccgtaactgcttattggttatcgatcaggcctatgctgaatatcttgatcctgaa
tgtgatgatggcgcgttagcactcgccaaaaacacaaaaaatgtactggtaacgcggaca
ttttctaaaatttacggattggccgctgaaagaattggctgggcttatgcttgccctgaa
atcattgatgcccttaaccggatacgggcacccttcaatgtcacgattgcgggacaaaag
gcagcggtcgccgctttggaagatcaggctttcatccagaacagcttcaaacataacaaa
aaatggcgtggctggtttgaaaaccagatggcgcttttaagtaatgctggcattcgtgtt
atcccgtcctctgccaattttactttactgctgtttgaaggcagcctgacggctgaaacc
gcctataaagccttgatggatcacggctataccacccgttggttgccgggacagcgcctt
cctcatgcattacgtatcactatcggcagtgaaaaacatatgcaggatgtcgctggtatt
ttaacttccttggttaggcaggcgctctaa

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0560
Entry
ZMO0560           CDS       T00221                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00340  Histidine metabolism
zmo00350  Tyrosine metabolism
zmo00360  Phenylalanine metabolism
zmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmo00401  Novobiocin biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ZMO0560
   00350 Tyrosine metabolism
    ZMO0560
   00360 Phenylalanine metabolism
    ZMO0560
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZMO0560
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    ZMO0560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zmo01007]
    ZMO0560
Enzymes [BR:zmo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     ZMO0560
Amino acid related enzymes [BR:zmo01007]
 Aminotransferase (transaminase)
  Class II
   ZMO0560
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 Alliinase_C
Other DBs
NCBI-ProteinID: AAV89184
UniProt: Q5NQ21
Position
556852..558000
AA seq 382 aa
MSEANLFRRRLMQMAVGGIVAAPFVQKSVLSAATPLSSNSSFETPDSLLGEMSDGVFINY
NENPLGPCAKAREALAKTIPFSGRYGMNFAENISKIISQQENIPVDYLHFFAGSTVPLHA
AAMAFSDKDHAIAYPLPTFDIFFKAPDGKNFAPLKPVPVNEKHQIDVAAMLSAAPDAGLY
YICNPNNPTGVVTPMRDIEWLLAHKPANSVVLVDEAYIHYSDMPSAMSLVAQGKDVVVLR
TFSKIYGLAGMRLGFAAARPDLLEKITYFDTNNPPMPAFAAAEASLLDEKLLPERKAYNK
AVRNDIFAWLSKRGYKYTPSEASFFMVHVGRPGQHVTDALKKYKVFISGTRPRYPDWVRV
SVGSFAEMNAFKAAFEKVMASA
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgagtgaggccaatttatttcgtcgccgtttaatgcagatggccgtagggggtattgtc
gctgcacctttcgttcagaaaagcgttctatcagcggcaacgccattatcttctaattcg
tcttttgaaacgccggatagcctgcttggtgaaatgagtgacggcgtttttatcaattat
aatgaaaatcccttgggtccctgcgctaaggcgagagaggccttggcgaaaacaattcca
tttagtggtcgctatgggatgaattttgctgagaatatttcgaaaattatcagtcagcaa
gaaaatattccggtcgattatctccatttttttgcgggatcaacggttccccttcacgcc
gccgccatggctttttctgataaagaccatgccattgcttatccgcttcctacttttgat
atttttttcaaagcgccagacggtaaaaattttgcccctctaaagccggtgccggtcaat
gagaagcatcaaattgatgtcgcggctatgttatctgcggcaccagatgccggtctttac
tatatttgtaatccgaataatccgaccggtgttgttacgccgatgcgcgatatagaatgg
ctgctcgcacataaacccgctaattccgttgttttggtcgatgaagcctatattcattac
agcgatatgccttcggcaatgtcccttgttgcacagggaaaagatgtggtcgtgcttcgg
actttctctaaaatttacggcttggcagggatgcgccttggttttgcagccgctcgtcct
gatttgttagagaaaataacctatttcgatactaataatccccccatgccggcatttgct
gcggctgaagccagccttttagatgaaaaattattaccggagcgaaaggcttataacaaa
gccgttcgaaatgatattttcgcttggctctcgaaacgaggttacaaatatacgccatca
gaagcctctttttttatggtgcatgttgggcggcctgggcaacatgttacggatgcattg
aaaaaatataaggtttttatttctggaactcgaccgcgctatcctgactgggtgcgcgtt
tccgtgggtagttttgcggaaatgaatgcctttaaggcggcttttgaaaaggtaatggcc
tcagcttaa

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0562
Entry
ZMO0562           CDS       T00221                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00340  Histidine metabolism
zmo00350  Tyrosine metabolism
zmo00360  Phenylalanine metabolism
zmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmo00401  Novobiocin biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ZMO0562
   00350 Tyrosine metabolism
    ZMO0562
   00360 Phenylalanine metabolism
    ZMO0562
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZMO0562
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    ZMO0562
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zmo01007]
    ZMO0562
Enzymes [BR:zmo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     ZMO0562
Amino acid related enzymes [BR:zmo01007]
 Aminotransferase (transaminase)
  Class II
   ZMO0562
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 Alliinase_C
Other DBs
NCBI-ProteinID: AAV89186
UniProt: Q5NQ19
Position
560720..561877
AA seq 385 aa
MDNLSKNHFGRRHLMQWAVGGLVAVPLLNHSALSANSPPVSESHFETLDSFLGDLKDGVF
INYNENPLGPCAKAREALAKTIPLSGRYESGFIKNIAQIISQQENIAVDYLHFFAGSSVP
LHAAAIAFSDKDHAIAYPLPTFDKFFRKPNGQSFAPLISVPVNEKHQIDVAAMLSAAPDA
GLYYICNPNNPTGVVTPMRDIEWLLAHKPANSVVLVDEAYIHYSDMPSAMSLVAQGKDVV
VLRTFSKIYGLAGMRLGFAAARPDLLEKIVDLDFNHPPFPAFAAAEASLLDEKLLPERKA
YNKAVRNDIFAWLSKRGYKYTPSEASFFMVHVGRPGQQVTDALKKYKVFISGTRPRYPDW
VRVSVGSFAEMNAFKAAFEKVMASA
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggataatttatcaaaaaaccattttggtcgccgtcatttaatgcaatgggctgtcgga
ggtcttgtcgctgttcctttactgaatcactcggctctttcagcaaattcgccgcctgta
tcagaaagccattttgaaacattggacagctttcttggtgatcttaaagacggcgttttt
atcaattataatgaaaatcccttgggtccctgcgctaaggcgagagaggccttggcaaaa
acaattccgcttagtggccgatatgaatctggatttatcaagaatattgcacaaattatt
agtcagcaagaaaatatcgcggtcgattatctccatttttttgccggatcgagtgttcct
cttcatgctgccgcaatagcgttttctgataaagatcatgccattgcttatccgcttcct
acttttgataaattttttcggaagcctaatggtcaaagctttgcacctttaatttctgtt
ccggtcaatgagaagcatcaaattgatgtcgcggctatgttgtctgcggcgccagatgcc
ggtctttactatatttgtaatccgaataatccgaccggtgttgtcacgccgatgcgcgac
atagaatggctgctcgcacataaacccgctaattccgttgttttggtcgatgaagcctat
attcattacagcgatatgccttcggcaatgtcccttgttgcacagggaaaagatgtggtc
gtgcttcggactttctctaaaatttacggcttggcagggatgcgccttggttttgcagcc
gctcgtcctgatttattagaaaagattgtcgaccttgatttcaatcatcctcctttcccg
gcatttgctgcggctgaagccagccttttagatgaaaaattattaccagagcggaaggct
tataacaaagcggttcgaaatgatattttcgcttggctctcgaaacgaggttacaaatat
acgccatcagaagcctctttttttatggtgcatgttgggcggcctgggcaacaggttacg
gatgctttgaaaaaatataaggtttttatttctggaactcgaccgcgctatcctgattgg
gtgcgcgtttccgtaggtagttttgcggaaatgaatgcctttaaggcggcttttgaaaag
gtaatggcctcagcttaa

DBGET integrated database retrieval system