KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0061
Entry
ZMO0061           CDS       T00221                                 

Definition
(GenBank) histidine acid phosphatase
  KO
K01093  4-phytase / acid phosphatase [EC:3.1.3.26 3.1.3.2]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00562  Inositol phosphate metabolism
zmo00740  Riboflavin metabolism
zmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ZMO0061
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ZMO0061
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     ZMO0061
    3.1.3.26  4-phytase
     ZMO0061
SSDB
Motif
Pfam: His_Phos_2 FliX
Other DBs
NCBI-ProteinID: AAV88685
UniProt: Q5NRG9
Position
complement(55123..56424)
AA seq 433 aa
MKYWAILGSLLCVSLGSHALAAKHEPRYVLEKVVELSRHGVRPPTEKEAEEIASGTNRNW
PEWVTPLGELTGHGYAASLLKARYEGEYYRKTGLLKSGCGLSKDVYIWSSPVERSKATAL
AYVDGMFPACNIPIHYSDMDSDYLFHFNKLVPPNNAPDQAKAEIEQILGSNLATARQRMQ
PEIARLRAAVCIAGKSCPIFDTPWQIKTKDKGGISVTGLESLASIGQVLLLEYSENKPLS
EVAFGKAPDAATIGALLSLQTLRYDVGNDRLSAARQGGSVLLNQIRMALELGTGSASTTG
RQAIAGPPDVAYLLYVAHDTNIAFIRRLLSFTWQVGEYPRGNIPPSSSLVFERWQDRATK
KRFIRLYFQTQTLDQTRSLTPLDQRHPLLTAEFKKPDCQKTKVGTLCPFDGVIAQMNQAI
DYSTVAIAAHPVK
NT seq 1302 nt   +upstreamnt  +downstreamnt
gtgaaatattgggcgatactaggcagcctcctatgcgtttctttggggagccatgcgctc
gcggcgaaacatgagcctcgttatgtgctggaaaaggtggttgaactaagccgccatggc
gtccgtcccccgacagaaaaagaggccgaagaaattgccagcggcacaaatcggaattgg
ccggaatgggtaacaccgcttggggaattaaccggtcacggctatgccgcatcccttctc
aaagcacggtatgaaggggaatattaccggaaaaccggcctgttaaaatccggctgtggc
ctttcgaaagatgtctatatctggagcagtccagtcgaacgctcaaaagccaccgcctta
gcctatgtggatgggatgtttccggcttgtaatatccctatccattatagcgatatggat
tcagactatcttttccattttaataaattggtgccgccaaataacgcccccgatcaagcc
aaagctgaaatagaacaaattttgggaagcaatctcgccacagcacggcaaagaatgcag
cctgaaatagcacggcttcgggcagccgtctgtatcgccggaaaaagctgcccgatattc
gataccccttggcaaataaaaaccaaggataaaggcggtatatccgttaccggtctcgaa
agcttggccagtatagggcaggtgctgttactcgaatatagcgaaaacaaacccctttcc
gaggttgcttttggaaaagcccccgacgccgcgacaatcggcgctttgttatcgctacag
acgctccgctatgatgtcggaaatgatcgcctttcggctgccagacaaggcggatcagtt
ttattaaatcaaatccgcatggcattggaattaggaacaggcagcgcgtcaaccacgggc
agacaagccattgcagggcctccagatgtcgcttatttgctctatgttgcccatgatacc
aatatcgcctttatcagacgcttattatctttcacatggcaagtcggcgaatatcctcgc
ggcaatatcccacccagcagtagcctcgtttttgaaagatggcaggatcgcgcaacgaaa
aaacgctttatccggctttattttcaaactcagacgctcgaccaaacgcgatcactcacg
ccgctcgatcaacgtcatcctctgctgacagccgaatttaaaaaaccggattgtcaaaag
accaaggtcgggacgctttgtcctttcgatggcgtaattgctcaaatgaaccaagcgatt
gattattcgactgttgctatcgctgcccatccggtaaagtaa

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0130
Entry
ZMO0130           CDS       T00221                                 

Definition
(GenBank) Acid phosphatase
  KO
K09474  acid phosphatase (class A) [EC:3.1.3.2]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00740  Riboflavin metabolism
zmo01100  Metabolic pathways
zmo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ZMO0130
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ZMO0130
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     ZMO0130
SSDB
Motif
Pfam: PAP2 PAP2_3 FliG_M
Other DBs
NCBI-ProteinID: AAV88754
UniProt: P14924
Position
complement(118385..119179)
AA seq 264 aa
MIKVPRFICMIALTSGILASGLSQSVSAHTEKSEPSSTYHFHSDPLLYLAPPPTSGSPLQ
AHDDQTFNSTRQLKGSTRWALATQDADLHLASVLKDYACAAGMNLDIAQLPHLANLIKRA
LRTEYDDIGRAKNNWNRKRPFVDTDQPICTEKDREGLGKQGSYPSGHTTIGWSVALILAE
LIPDHAANILQRGQIFGTSRIVCGAHWFSDVQAGYIMASGEIAALHGDADFRRDMELARK
ELEKARTSAHTPDDLLCKIEQSAR
NT seq 795 nt   +upstreamnt  +downstreamnt
atgataaaagtcccgcggttcatctgtatgatcgcgcttacatccggcattctggcaagc
ggcctttctcaaagcgtttcagctcatacagaaaaaagtgaaccctcctcgacttatcat
ttccacagcgatccccttctttaccttgcgcccccacccacttccggcagtccattacag
gcgcatgatgatcaaacctttaacagcaccagacaattaaaaggtagcacgcgctgggca
ttggcaactcaagatgccgatcttcatctcgcttcagttctcaaagactatgcctgcgcc
gcaggaatgaatctcgatattgcgcaattaccgcatcttgccaatttgattaaacgcgca
cttcgcaccgaatatgacgatattggcagagccaaaaataactggaatcgcaaacggcct
tttgtggataccgatcaacccatctgcacggaaaaagatcgcgaaggtctgggaaaacaa
ggctcctatccttcaggtcatacgactatcggttggagcgttgcactcattctggctgaa
ttgatccccgatcatgcggcgaatattttgcagcgtggccaaatttttggaaccagccgg
attgtctgcggcgcccattggttcagcgatgtgcaggcaggctatatcatggcatcgggc
gaaattgcagctttacatggggatgccgatttccgccgagatatggaattagctcggaaa
gaattagaaaaggcacgcacatcagcgcacacgccagacgatcttctatgcaagattgaa
caaagcgctcgctaa

DBGET integrated database retrieval system