KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0105
Entry
ZMO0105           CDS       T00221                                 

Definition
(GenBank) 3-isopropylmalate dehydratase, large subunit
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00290  Valine, leucine and isoleucine biosynthesis
zmo00660  C5-Branched dibasic acid metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01210  2-Oxocarboxylic acid metabolism
zmo01230  Biosynthesis of amino acids
Module
zmo_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    ZMO0105
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ZMO0105
Enzymes [BR:zmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     ZMO0105
    4.2.1.35  (R)-2-methylmalate dehydratase
     ZMO0105
SSDB
Motif
Pfam: Aconitase
Other DBs
NCBI-ProteinID: AAV88729
UniProt: Q5NRC5
Position
91652..93106
AA seq 484 aa
MTKNPRTLYEKIWDAHIVERREDGSALIYIDRHLVHEVTSPQAFEALRQAGRPLRRPDRT
LAVPDHNVPTTARVDSEGHLLPIADPQSAKQLAALAKNAPEFGVRYISATDPEQGIVHVV
GPEQGFTLPGTTLVCGDSHTAAHGALGALAFGIGTSEVEHVMATQTLILTPAKTMEVRVE
GKLSPDVSAKDLILHIIHSLGTAGGTGYAIEYTGEAIRNLSIEERLTVSNMSIEAGARTG
LIAADEKTFAYLFGRPMAPKGADWEKAVQWWKSLATDKGAVYDKTVIIKAEDVQPSVTWG
TSPEDVVPITGVVPDPASFADPAKQAAARRSLEYMGLEPGQKMEGLAVENVFIGSCTNSR
IEDLRAAASVVWGRHVADNVKQALVVPGSGLVKRQAEAEGLDEVFKAAGFEWREPGCSMC
LAMNPDKVPAGERCASTSNRNFVGRQGPGARTHLVSPAMAAAAAVTGHLTDLRHLEPVKM
GEKA
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgacaaaaaatccccgcactctttatgaaaaaatatgggacgctcatattgtcgagcgt
cgtgaggatggttctgctcttatctatatcgatcggcatcttgtccatgaagtgaccagc
ccgcaggcttttgaagccctgcgtcaggcaggtcgccccttgcgtcgccctgatcggact
ttggcggtgccggatcacaatgtgccgacaaccgcacgtgtcgatagtgaaggccatctg
ttaccaattgctgacccacaatcggcaaagcaattagcggctttggctaaaaatgcgccg
gaatttggggttcgctatatcagtgcgactgaccctgagcagggcattgtccatgtcgtg
ggcccggaacaaggttttaccttgcccggaacgactttggtttgtggtgatagtcatacg
gcggctcatggggccttgggggctttggctttcggtatcgggacttccgaagtcgaacat
gtcatggcaacccagactttgatcctgacccctgccaagactatggaagttcgggttgaa
ggcaagctgtctcccgatgtgtcggcaaaagacctgatccttcatatcattcatagctta
ggcacggcaggcggcaccggatatgctattgaatataccggtgaggcgatccgcaatctg
tcgatcgaagagcgtctgaccgtttccaatatgtcgatcgaagcgggtgcgcgcaccgga
ttgattgcagcggatgaaaagacctttgcctatctctttggtcgtccgatggcacccaaa
ggcgcagattgggaaaaagcggtgcagtggtggaagtctttggcgactgataagggggct
gtttatgacaagaccgttatcattaaagccgaggatgttcagccttccgtgacatggggc
accagccctgaagatgtggtaccgattaccggcgttgtgcctgatccggcttcttttgct
gaccctgccaaacaggcggcggcgcgtcgttctctggaatatatggggttagaacccggc
cagaaaatggaaggtctggcagttgaaaacgtctttatcggaagctgcaccaatagccgt
attgaagatttgagagcggcggcttcggtcgtttgggggcggcatgttgccgataacgtt
aaacaggctttggtcgttcccggatccggtttggtaaaacgtcaggccgaggctgaaggt
ttggatgaagtctttaaagcggctggctttgaatggcgtgaacccggttgttcgatgtgt
ttggcgatgaatcccgataaggttccagcaggtgagcgttgtgcttcgacctcgaaccgt
aacttcgtcggacggcagggtcccggtgccagaacccatctggtttcacctgctatggcg
gccgctgcggctgtgaccggacatctgaccgacctgcgtcatctggagccggttaaaatg
ggagaaaaggcatga

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0106
Entry
ZMO0106           CDS       T00221                                 

Definition
(GenBank) 3-isopropylmalate dehydratase, small subunit
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00290  Valine, leucine and isoleucine biosynthesis
zmo00660  C5-Branched dibasic acid metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01210  2-Oxocarboxylic acid metabolism
zmo01230  Biosynthesis of amino acids
Module
zmo_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    ZMO0106
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ZMO0106
Enzymes [BR:zmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     ZMO0106
    4.2.1.35  (R)-2-methylmalate dehydratase
     ZMO0106
SSDB
Motif
Pfam: Aconitase_C Aconitase_2_N
Other DBs
NCBI-ProteinID: AAV88730
UniProt: Q5NRC4
Position
93103..93681
AA seq 192 aa
MKAVKIVEGRAYPLGESNIDTDIIIPAHYLKTTDRKGLAKGAFETIRAKEGNVFDNPEYK
GAPILIAGDNFGCGSSREHAAWAIKEMGVEAVIAPRFSDIFSGNAFKNGLLTVVLPEADV
ERLLEVAKTDPITLDLENQVVTTPFQDRFHFDIDPFRKRCLLEGLDEIGLTLKDQDKISQ
YEDVLASDRPWV
NT seq 579 nt   +upstreamnt  +downstreamnt
atgaaagctgtcaaaatagtcgaaggtcgtgcctatccgttgggcgaaagtaatattgat
acggatattattattccggctcattatctgaaaacgaccgaccgtaagggtttggcaaaa
ggtgcctttgaaactattcgggcgaaagaaggcaatgtctttgacaatcccgaatataag
ggcgcgcctattttgattgccggtgacaatttcggttgcggttccagtcgagaacatgcg
gcttgggcgattaaggaaatgggtgttgaggcggtgatcgcgcctcgtttttcggatatt
ttttccgggaatgccttcaaaaacggtttgttgacggttgttttgccggaagccgatgtt
gagcgtttattagaagtcgccaagactgatcccattacgcttgatcttgaaaatcaggtg
gtcacgaccccttttcaggatcgctttcatttcgacattgatcctttccgcaagcgttgc
ctgttggaaggtttggatgaaatcggtctgactttgaaagatcaggacaaaattagccaa
tatgaagacgtgttggccagtgatcgtccttgggtctag

DBGET integrated database retrieval system