KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0115
Entry
ZMO0115           CDS       T00221                                 

Definition
(GenBank) aminotransferase class IV
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00270  Cysteine and methionine metabolism
zmo00280  Valine, leucine and isoleucine degradation
zmo00290  Valine, leucine and isoleucine biosynthesis
zmo00770  Pantothenate and CoA biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01210  2-Oxocarboxylic acid metabolism
zmo01230  Biosynthesis of amino acids
zmo01240  Biosynthesis of cofactors
Module
zmo_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
zmo_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ZMO0115
   00280 Valine, leucine and isoleucine degradation
    ZMO0115
   00290 Valine, leucine and isoleucine biosynthesis
    ZMO0115
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ZMO0115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zmo01007]
    ZMO0115
Enzymes [BR:zmo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     ZMO0115
Amino acid related enzymes [BR:zmo01007]
 Aminotransferase (transaminase)
  Class IV
   ZMO0115
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-ProteinID: AAV88739
UniProt: Q5NRB5
Position
102981..103817
AA seq 278 aa
MPIWLNGVLANNAVAEFNLNDKGLLLGYGVFDTALVIADKVAYREAHLEKLTKSCAALSL
PVASSFLSEMMEKAAKDLPLGVIRITVTGGVGPRGMAFSPEAKPNVIVSASPIAATIFCP
EIRLVLTPLRRNESSFTARIKTLNYLDAIMAVTEARQKSFDDALFLNTAGHVACSSTANL
FMIRDGCLITPPVSDGILAGIMRANILRFAKSRDIPVEERSIGYEELLEADDIFLTNSLR
LISQVTHLGEVALPRRSAALMALLESMVFDEINYSRSQ
NT seq 837 nt   +upstreamnt  +downstreamnt
atgccgatatggctgaacggtgtattagccaataatgctgtcgcagaatttaacctgaat
gataaagggttattactgggatatggtgttttcgataccgccttggttatcgctgataaa
gttgcctatcgggaagcgcatcttgaaaaattgacaaaaagctgtgcggcgttgtccttg
ccggtcgcttcctcttttttaagcgaaatgatggagaaggcagcgaaagacctgcctttg
ggcgtaataaggatcaccgtgacggggggcgtgggcccaaggggaatggcttttagtccc
gaagccaagcctaatgttattgtgtcggcttccccgatagcagcgacaatattttgtcct
gagatacggcttgtcttgacgccacttcggcggaatgaaagctcttttacggcgcggatt
aaaacgctgaattatcttgatgcgattatggcggtgacagaagcgcgtcagaagtctttt
gatgatgcgctgtttttaaataccgcagggcatgttgcctgtagtagcacggccaatctt
tttatgatccgtgacgggtgtttgattactccgccagtcagtgatggtattttggcaggt
attatgcgtgccaatattctgcgttttgcaaaatcccgtgatattccggttgaagagcgc
tctattggctatgaagagctgttagaggcagatgacatcttcctaaccaatagtttgcgt
ctgatcagtcaggtgacgcatttaggggaggttgctttgccgcgtcggtcggcggccttg
atggctttgctggagtcgatggtttttgacgagattaattacagccgttctcaatag

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0913
Entry
ZMO0913           CDS       T00221                                 

Definition
(GenBank) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00270  Cysteine and methionine metabolism
zmo00280  Valine, leucine and isoleucine degradation
zmo00290  Valine, leucine and isoleucine biosynthesis
zmo00770  Pantothenate and CoA biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01210  2-Oxocarboxylic acid metabolism
zmo01230  Biosynthesis of amino acids
zmo01240  Biosynthesis of cofactors
Module
zmo_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
zmo_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ZMO0913
   00280 Valine, leucine and isoleucine degradation
    ZMO0913
   00290 Valine, leucine and isoleucine biosynthesis
    ZMO0913
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ZMO0913
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zmo01007]
    ZMO0913
Enzymes [BR:zmo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     ZMO0913
Amino acid related enzymes [BR:zmo01007]
 Aminotransferase (transaminase)
  Class IV
   ZMO0913
SSDB
Motif
Pfam: Aminotran_4 Glyco_trans_1_4 Glycos_transf_1
Other DBs
NCBI-ProteinID: AAV89537
UniProt: Q5NP23
Position
complement(927936..929036)
AA seq 366 aa
MSQTKETSILTIEPTDHPTPADKRKAMMANPGFGTTFSDHMVVIHYSEEKGWHNGRVMAR
QPLPLDPAASVLHYAQEIFEGMKAYRSPENEILLFRPEENARRFRHSAEVMAMEPIPEEI
FLDAVHKLVDIDRDWVPDGEVGSLYIRPFQIASQPFLGVKPAKEYIFAIIACTVGSYFKD
ATKGVPIWVSENHVRAVPGGTGTAKCGGNYAASLTAQAEGYAHGCAQVVFLDAIERRWIE
ELGGMNVFFVMNGKTLITPPLKGTILHGITRKSIIALARDKGYTVLEQPYSLDQWREDAK
SGKLLEAFACGTAAVITSIGKVCDTHGDFEIGENGANNPVANELRESLINLQYGRAEDPY
GWVKRV
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgtctcaaacgaaagaaacctctattcttacgatagaacccactgaccatcctacgccc
gctgataaacgcaaggcgatgatggctaatcctggcttcggcacgaccttttctgatcat
atggttgtgattcactattccgaagaaaaaggatggcataacggacgggttatggctcgc
cagccgttaccactcgatccggccgcttcagtgttgcattacgcgcaggaaattttcgaa
gggatgaaggcctatcgcagtcccgaaaatgaaattttgctgttccggcccgaagaaaat
gcccgtcgtttccgccattcagcagaagttatggcgatggaacccattccagaagaaatc
tttctggatgccgtgcataagctggtcgatattgatcgtgactgggtgcctgatggtgaa
gtaggtagcctttatattcgtcctttccaaattgccagccagcctttccttggcgtgaaa
cctgccaaagaatatattttcgcgattatcgcttgtacggttggctcctatttcaaggat
gcaaccaaaggtgtgccgatttgggtctccgaaaatcatgttcgggcagttcccggtggt
actggtacggccaaatgtggcggtaattatgcagccagtctgacagctcaagccgaaggc
tacgctcatggttgtgcacaggttgtcttcttggatgctatcgaacgccgttggattgaa
gaacttggtgggatgaatgtcttttttgtcatgaatggcaaaacattaatcacccctccg
ctgaaaggcacgattctccacggaattaccagaaagtcgatcatcgcattagcccgcgac
aaaggatataccgttctggaacagccctatagccttgatcaatggcgtgaagatgccaaa
tctggcaaattgctggaagcctttgcctgtgggacagccgcggttattacttctatcggt
aaagtatgcgacacacatggcgattttgagattggtgaaaatggcgctaataatccagta
gccaatgaactgagagaatctctgattaacttgcagtatgggcgcgcagaagatccttat
ggctgggtcaaacgcgtttaa

DBGET integrated database retrieval system