KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0152
Entry
ZMO0152           CDS       T00221                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00230  Purine metabolism
zmo00620  Pyruvate metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
zmo01230  Biosynthesis of amino acids
zmo01240  Biosynthesis of cofactors
Module
zmo_M00002  Glycolysis, core module involving three-carbon compounds
zmo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
zmo_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0152
   00620 Pyruvate metabolism
    ZMO0152
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ZMO0152
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:zmo04131]
    ZMO0152
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zmo04147]
    ZMO0152
Enzymes [BR:zmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     ZMO0152
Membrane trafficking [BR:zmo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ZMO0152
Exosome [BR:zmo04147]
 Exosomal proteins
  Proteins found in most exosomes
   ZMO0152
SSDB
Motif
Pfam: PK PK_C FlpD
Other DBs
NCBI-ProteinID: AAV88776
UniProt: Q5NR78
Position
complement(136652..138079)
AA seq 475 aa
MTEGLFPRGRKVRVVSTLGPASSTAEQIRDRFLAGADVFRINMSHGTHDEKKVIVDNIRA
LEKEFNRPTTILFDLQGPKLRVGDFKEGKVQLKEGQTFTFDQDPTLGDETRVNLPHPEIF
KALDKGHRLLLDDGKIVVRCVESSPTKIVTRVEVPGPLSDHKGFNVPDVVIPLAALTPKD
RKDLDFALQEKADWVALSFVQRVEDVIEAKELIKGRAPLLVKLEKPAAIENLESILAATD
AVMVARGDLGVECLPESVPPTQKRIVERSRQLGKPVVVATAMLESMIKAPAPTRAEVSDV
ANAIYEGADGIMLSAESAAGDWPHEAVNMMHRIASYVENAPGYIERVRFTPTPAEPTTVD
ALAENASKTAETVGAKAIIVFTETGKTAQRVSRARPVAPILSLTPDAEVARRLGLVWGAQ
PVQVSTVKTLDEAKKLAAETAKKYGFAKAGDKLVVVAGEPFGKAGTTNIVDVIEA
NT seq 1428 nt   +upstreamnt  +downstreamnt
ttgactgaaggacttttcccacgcggccgcaaggtacgtgttgtttctacgctgggtcct
gccagctcgacggcagaacagattcgtgatcgtttcttggctggtgcggatgtattccgt
atcaacatgagccatggtacccatgacgaaaagaaggtcatcgttgacaacattcgtgcg
cttgaaaaagaattcaaccgcccgaccacgatccttttcgatcttcagggtccgaagctc
cgcgttggtgacttcaaagaaggcaaggttcagttgaaagaaggccagaccttcactttc
gatcaggacccaactctcggtgacgaaacccgcgtcaacctgccgcatcctgaaatcttc
aaggctttagacaaaggtcatcgcctgcttttggatgatggtaagatcgttgttcgttgc
gtcgaatcttccccgaccaaaatcgttacccgcgtcgaagttccgggtccgctttccgac
cataaaggtttcaacgttcctgacgttgtgattccgctggccgctctgaccccgaaagat
cgcaaagatctcgactttgctcttcaggaaaaagctgactgggttgctcttagctttgtg
cagcgcgtcgaagacgtcatcgaagccaaagaactcatcaaaggtcgcgcaccgcttctc
gttaaactcgaaaagccagctgccattgaaaacctcgaatccatcttggctgcaaccgat
gctgtcatggttgctcgtggtgacctcggtgttgaatgcttgccggaatccgttcccccg
acgcagaagcgtatcgttgaacgctcccgccagctgggtaagccggttgttgttgcaacc
gctatgctcgaatccatgatcaaagctccggctccgacccgcgctgaagtaagtgacgtt
gcaaacgccatttacgaaggtgctgatggtatcatgctttctgcagaatccgccgccggt
gattggccgcatgaagctgtcaacatgatgcatcgtattgcttcttatgttgaaaatgct
ccgggttacatcgaacgcgttcgcttcaccccgactccggcagaaccgacgacggttgat
gctctggctgaaaacgccagcaaaaccgctgaaacggttggcgcaaaagcgatcatcgtc
ttcaccgaaaccggtaagaccgcacagcgcgtttcccgcgcccgtccggttgctccgatc
ctgtctctgaccccggatgccgaagttgctcgtcgtcttggtttggtctggggcgcacag
ccggttcaggtttccacggttaagaccctcgacgaagccaagaagctggctgctgaaacc
gctaaaaaatacggtttcgccaaagccggtgacaagctggttgttgttgcaggtgaacct
ttcggtaaagctggaaccaccaacattgttgatgttatcgaagcctaa

DBGET integrated database retrieval system