KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0177
Entry
ZMO0177           CDS       T00221                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
zmo01230  Biosynthesis of amino acids
Module
zmo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0177
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:zmo04131]
    ZMO0177
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zmo04147]
    ZMO0177
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     ZMO0177
Membrane trafficking [BR:zmo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ZMO0177
Exosome [BR:zmo04147]
 Exosomal proteins
  Proteins found in most exosomes
   ZMO0177
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N ADH_zinc_N
Other DBs
NCBI-ProteinID: AAV88801
UniProt: P09316
Position
161477..162490
AA seq 337 aa
MAVKVAINGFGRIGRLAARAILSRPDSGLELVTINDLGSVEGNAFLFKRDSAHGTYPGTV
TTEGNDMVIDGKKIVVTAERDPANLPHKKLGVDIVMECTGIFTNTEKASAHLTAGAKKVL
ISAPAKGDVDRTVVYGVNHKDLTADDKIVSNASCTTNCLAPVLHVLQQKIGIVRGLMTTV
HSFTNDQRILDQIHSDLRRARTASASMIPTSTGAARAVALVIPELKGKLDGISIRVPTPD
VSLVDFTFVPQRDTTAEEINSVLKAAADTGDMTGVLGYTDEPLVSRDFYSDPHSSTVDSR
ETAVLEGKLARVVAWYDNEWGFSNRMVDTAAQMAKTL
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcggttaaagttgcgattaatggcttcggccgtatcggccgtctggctgcgcgtgca
attctgtcgcgtccggattctggacttgaactggttaccatcaatgacctgggtagcgtt
gaaggcaacgctttcttgttcaagcgtgacagtgcacatggcacctatccgggtaccgtt
accaccgaaggtaacgacatggtcatcgatggcaagaaaattgttgtcaccgctgaacgt
gatccggccaatctgccgcacaaaaagcttggcgttgatatcgtgatggaatgcacgggt
atcttcaccaacaccgaaaaagcttctgctcatctgaccgcaggtgccaagaaggttctg
atttctgctccggctaaaggcgatgttgatcgcaccgttgtttatggtgtgaaccacaaa
gacctgaccgcagatgacaagatcgtttctaacgcatcttgcaccaccaactgcttggct
ccggttctgcatgttcttcagcagaaaatcggtatcgttcgtggtttgatgaccaccgtt
cacagcttcaccaacgatcagcgcatcctcgatcagatccattctgatctgcgtcgtgcc
cgcacggccagcgcttccatgatcccgaccagcaccggtgctgcccgcgctgttgctctc
gtgatcccggaactcaaaggtaagctggatggtatctccatccgcgtcccgaccccggat
gtcagccttgttgacttcaccttcgttccgcagcgtgacacgaccgcagaagaaatcaac
agcgttcttaaagccgctgctgacaccggtgatatgactggcgttctcggttacaccgac
gaacccctcgtttcccgtgacttctactccgatccgcacagctccaccgttgacagccgt
gaaacggccgttctcgaaggtaagctggctcgcgttgttgcatggtatgacaacgaatgg
ggcttctccaatcgtatggtcgataccgctgctcagatggctaaaacgctctag

DBGET integrated database retrieval system