KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0178
Entry
ZMO0178           CDS       T00221                                 

Definition
(GenBank) Phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
zmo01230  Biosynthesis of amino acids
Module
zmo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0178
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zmo04147]
    ZMO0178
Enzymes [BR:zmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     ZMO0178
Exosome [BR:zmo04147]
 Exosomal proteins
  Proteins found in most exosomes
   ZMO0178
SSDB
Motif
Pfam: PGK DUF2514 Arg_tRNA_synt_N
Other DBs
NCBI-ProteinID: AAV88802
UniProt: P09404
Position
162713..163906
AA seq 397 aa
MAFRTLDDIGDVKGKRVLVREDLNVPMDGDRVTDDTRLRAAIPTVNELAEKGAKVLILAH
FGRPKGQPNPEMSLARIKDALAGVLGRPVHFINDIKGEAAAKAVDALNPGAVALLENTRF
YAGEEKNDPALAAEVAKLGDFYVNDAFSAAHRAHVSTEGLAHKLPAFAGRAMQKELEALE
AALGKPTHPVAAVVGGAKVSTKLDVLTNLVSKVDHLIIGGGMANTFLAAQGVDVGKSLCE
HELKDTVKGIFAAAEKTGCKIHLPSDVVVAKEFKANPPIRTIPVSDVAADEMILDVGPKA
VAALTEVLKASKTLVWNGPLGAFEIEPFDKATVALAKEAAALTKAGSLISVAGGGDTVAA
LNHAGVAKDFSFVSTAGGAFLEWMEGKELPGVKALEA
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcttttcgtacattagatgatattggtgacgtcaaaggtaagcgcgttcttgttcgc
gaagatctgaacgttcctatggatggcgatcgcgttacggatgatacccgtctgcgcgct
gcaatcccgaccgttaatgaattggctgaaaagggcgccaaagtccttattttggctcac
ttcggtcgtccaaaaggtcagccgaatcctgaaatgtccttggctcgcatcaaagatgcg
ctggctggcgttctgggtcgtccggttcacttcatcaatgacatcaaaggtgaagctgca
gcaaaagccgttgatgccctgaatcctggtgccgttgctcttcttgaaaacacccgcttt
tatgctggtgaagaaaagaatgatccggctctggcagcagaagtagctaagctcggcgat
ttctatgtcaatgatgctttctcggctgctcaccgcgcccatgtttcgaccgaaggtctg
gctcacaagctgcctgctttcgctggtcgtgccatgcagaaagaattagaagctcttgaa
gctgcccttggtaagccgacccatccggtcgcagccgttgtcggtggtgctaaagtttct
accaagctcgacgttctgaccaaccttgtttccaaggttgaccatctgatcatcggtggt
ggtatggctaataccttcctcgctgctcagggtgttgatgttggtaaatccctttgtgag
catgagctgaaagataccgttaaaggtattttcgctgctgctgaaaaaacgggctgcaaa
atccatcttccgagcgatgtcgttgtcgccaaggaattcaaagccaatccgccgatccgt
accattccggtcagcgacgttgctgctgacgaaatgatccttgacgttggcccgaaagcc
gtcgctgctttgaccgaagttctgaaagcttccaagaccttggtctggaatggcccgttg
ggcgctttcgaaattgaacctttcgataaagccacggttgctctcgctaaggaagccgct
gctttgaccaaagccggttctttgatctctgttgctggtggtggtgacacggttgccgct
cttaaccatgctggtgtggcaaaagactttagctttgtctcaacggctggtggtgctttc
cttgaatggatggaaggtaaagagctgccgggtgttaaagccctcgaagcttaa

DBGET integrated database retrieval system