KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0179
Entry
ZMO0179           CDS       T00221                                 

Definition
(GenBank) Fructose-bisphosphate aldolase
  KO
K11645  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00030  Pentose phosphate pathway
zmo00051  Fructose and mannose metabolism
zmo00680  Methane metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0179
   00030 Pentose phosphate pathway
    ZMO0179
   00051 Fructose and mannose metabolism
    ZMO0179
  09102 Energy metabolism
   00680 Methane metabolism
    ZMO0179
Enzymes [BR:zmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     ZMO0179
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: AAV88803
UniProt: Q5NR51
Position
164675..165589
AA seq 304 aa
MSITPEVKAILDLYESDNPGTKANLARILNHGRLGGTGKLIILPVDQGLEHGPARSFYPN
PAGYDPQYHYKLAIDGGFSAFAAPLGMLETGAATFAGQIPTILKMNSSNSWSSVNDQAVT
SCVGDALRLGCSAVGFTIYPGSDIIFEQIEEFRHIAAEAKRCGLATVIWAYPRGGRLTKR
GETALDVSAYAVHIAAQIGGHIIKVKLPTSHIEQPEAIPAYSGKDWAPLANRVSHIMESA
FAGRRMVVFSGGEAKTPDELFKEAEAIRDGGGFGSIMGRNVFQRSREEALELVDKIVEIY
KKKD
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtctattactcccgaagtaaaagctattcttgatctttatgaaagtgataatcccggg
acaaaggctaatcttgctcgtattttgaatcatggccgtttgggtggcactggcaagctg
attattttgccggtcgatcaaggtttagaacatggccctgcgcgcagtttttatcctaat
cccgccggatatgatccccaatatcattataaattagcaattgatggcgggttttctgct
tttgcggcaccgcttgggatgctggaaacgggagccgcgacttttgccggtcaaataccg
actattttgaagatgaattcttcgaatagttggtcctctgtgaacgatcaggcggtcact
tcttgtgtcggcgatgcgttaagattgggatgttcggcggttggttttacgatttatccc
ggttccgatattatctttgagcagattgaagaattccgccatattgcggcagaagccaaa
agatgcggattggcaaccgttatttgggcctatccacgcggtggacgattgaccaaaaga
ggcgaaacggccttggatgtcagtgcctatgctgtgcatatcgctgcccagattggtggt
catattatcaaggtgaaattaccgacttctcatatcgaacagcctgaagctatcccagct
tattcaggaaaagactgggcaccattagctaaccgagtttcccatattatggaatcagcc
tttgcaggtcggcgtatggtagtcttttcaggtggcgaagcaaaaacgccggatgagctt
tttaaagaagccgaagctattcgcgacggtggcggctttggttcaattatgggacggaat
gttttccagcgttcaagagaagaagccttggagctggtggataaaattgtcgagatttat
aagaagaaagattga

DBGET integrated database retrieval system