KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0180
Entry
ZMO0180           CDS       T00221                                 

Definition
(GenBank) 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase
  KO
K03526  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00900  Terpenoid backbone biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ZMO0180
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.1  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (ferredoxin)
     ZMO0180
    1.17.7.3  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin)
     ZMO0180
SSDB
Motif
Pfam: GcpE
Other DBs
NCBI-ProteinID: AAV88804
UniProt: Q5NR50
Position
complement(165746..166879)
AA seq 377 aa
MSIRPWRHIERRKSRKIMVGNVAVGGDAPISVQTMTNTPTVDAQATIAQIKRCEAVGVDL
IRVSCPDKESTAALKDIVRAAEVPIIADIHFHYKRALEAADAGAACLRINPGNIGSSERV
AEVVRAAKANGCAIRIGVNAGSLEKELLEKYGEPCPDALVESALNHIKLLQDQDFHEFKV
AVKASDVFLAVASYKALAKAVDCPLHLGITEAGGLIGGTVKSALGIGNLLWDGIGDTLRV
SLSADPEQEVRVGYDILKTLDLRTRGVRVVSCPSCARQGFDVVKTVKALEERLAHIATPI
SLSILGCVVNGPGEARETDIGVTGGGQGKHMVFLSGVTDHTVEDAKMLDHIVSLVEAKAA
EIEAEKAKEKAATVAAE
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtccattcgtccttggcgccatatagagcgccgcaaatcgcgcaagatcatggttggt
aatgtagctgtcggtggcgatgccccgatcagtgtccagaccatgacaaacaccccgacc
gtcgatgctcaagccacgatcgcccagatcaaacgctgcgaagctgtcggtgtcgatctt
attcgggtctcctgtcccgataaagaatccaccgccgctttaaaggacattgtccgcgca
gccgaagtgccgatcatcgcggacatccattttcactataaacgcgctttagaagccgct
gatgcaggggcagcctgccttcgcatcaatcctggcaatatcggttcctccgaacgcgtt
gccgaagttgtccgcgcggcaaaagccaatggctgcgccatccgtatcggtgtgaatgcc
ggtagccttgaaaaagagctactcgaaaaatatggcgagccctgccccgatgcgctggtt
gaaagcgcccttaaccatattaaattattacaagaccaagatttccatgaattcaaggta
gccgtaaaggcttccgatgttttcttggccgttgcatcttataaagcgctagcgaaagct
gtcgattgcccgctccatctcggtatcaccgaagccggtggccttattggcggaaccgtt
aaatccgctctgggtatcggtaatctgttatgggatggtatcggcgatacgttacgcgtt
tcgctttccgctgatcccgagcaggaagtgcgggtcggctacgacattctcaagactttg
gatcttcgcactcgtggtgttcgggttgtttcctgccccagctgtgcaagacaaggcttt
gatgttgtcaaaacggtcaaggctctggaagaaagactggcccatattgctacgccaatt
tcgctttctattctgggctgcgtggtgaacgggcccggcgaagcacgggaaaccgatatc
ggcgttaccggtggcggtcagggtaagcatatggtcttcttgtccggtgtcaccgatcat
accgtcgaagatgccaaaatgctcgatcacatcgtttccttggtcgaagccaaagcagcc
gaaatcgaagccgaaaaagcaaaagagaaggcggccacggtcgccgccgaataa

DBGET integrated database retrieval system