KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0197
Entry
ZMO0197           CDS       T00221                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00550  Peptidoglycan biosynthesis
zmo01100  Metabolic pathways
zmo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO0197
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ZMO0197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:zmo01003]
    ZMO0197
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO0197
Enzymes [BR:zmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ZMO0197
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ZMO0197
Glycosyltransferases [BR:zmo01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   ZMO0197
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   ZMO0197
SSDB
Motif
Pfam: Transgly Transpeptidase PCB_OB
Other DBs
NCBI-ProteinID: AAV88821
UniProt: Q5NR33
Position
187445..190024
AA seq 859 aa
MSDPLKIRGTTSQRKKQKIQKKMSVKRFWHGKIFRSFFLLLVVGCSFSGFLFWRYFIRDL
PSVEMLADYHLPMPAVVRDGNGMPFGHFVREHREKLNYEDFPPVVIQAFLSAEDKSFFSH
HGINGAAFLKAVYEYFTKMGSGERAHGGSTITQQVAKNLLVGDEYSPTRKVKEALLAFQI
EHLLTKRQILEIYLNQIFLGRNAYGVSAAAKAYFGKTVKDLSLPEAAFLAILPKAPSNYT
PERYMERALGRRAYVLHQMMLNGYITAFQYTEASQTPLGVIKPHIIAKAPVKGGYFLEEV
RRELVNRFGESAKDGENNVYSGGLWVRTSFDPALQESAETALRDGFVRFERDHGWNGRVG
NIDPGEGWQERLIAANIGTGYADWYAAVILEKENGRAKIGFEDGQEDYLYPWGAAMPRHD
TETSAWRFLHEGDIIIVKKIDNFWILRSLPAVSGGMVVEDPHTGRVMAMQGGFDYRNGDF
NRATQAERQPGSTFKPFVYSAALDHGMTPASIIVDGPFCVYQSARLGMKCFRNFSGGYSG
PQTMRWGVEQSRNLMTVRAAAQTGMAHVVKMAEKAEINPPGHPYPPVLGIALGAGNTTVM
RLTNGYSMLANQGRRLHPSLIDYVQDRNGKVIYKSDDRICSGCNLPEWDGQPMPRPHHTN
GQAINAMTAYQMLHILEGVVQRGTAAILRDLGRPMFGKTGTSTGPTNVWFVGGSADLVAG
LYVGYDRPRSMGHSAQGGTVAAPIFKQFAQRSMTEMPVKPFPVAPDIHMVKIDRYSGLRI
YGSAPVNPADPMSPIIWEAFKPDNEPRRSFYRPAVVAAAVTPVSNNATDDSHKSEAAKAQ
PVAPPVNLPHPNDRSSLQK
NT seq 2580 nt   +upstreamnt  +downstreamnt
atgtctgatcccttaaaaataagggggacaacatcgcagcgaaaaaaacagaaaatacag
aaaaaaatgtctgttaaacgattttggcatggaaagatttttcggtctttctttctgttg
ttggttgtcggctgctctttttccggctttctgttctggcggtattttatccgagattta
ccatcagttgaaatgctggctgattatcatttgccgatgccggcggttgtgcgcgatggc
aatgggatgccctttggtcattttgttcgcgaacatcgtgaaaagctgaattatgaagat
ttcccgcctgtggttattcaggcttttttatcggcagaagataaatccttcttttcccat
cacgggatcaatggcgcggccttcttaaaagccgtgtatgaatattttaccaaaatgggc
agtggagaacgcgcccatggcggttctaccattacccagcaggtagccaagaatttattg
gtaggggatgaatattccccgacccgcaaagtcaaagaagctcttttggctttccagatc
gagcatctgttaacgaagcgccagattctagaaatttatctcaatcagatttttttaggg
cggaatgcctatggtgtcagtgccgccgctaaagcctatttcggaaaaacagtgaaagat
ctgtctttaccggaagcggcttttttagccattctgccaaaagcaccgtccaattatacc
cctgaacgctatatggagcgcgctttgggacggcgtgcttatgtcctgcatcagatgatg
ttgaatggctatattactgcctttcaatataccgaggctagtcaaacgcctttgggtgtt
attaagccgcatattatcgctaaagctcctgttaaggggggctattttcttgaagaagtg
cggcgggaattggtgaaccgttttggcgagagtgccaaagacggcgagaataacgtttat
tccggtgggttatgggttagaacctcttttgatcctgcgcttcaggaatccgccgaaacc
gccttaagggatggctttgttcgttttgaacgggatcatggttggaatggacgcgtcggg
aatattgatccaggtgaggggtggcaagaacggctgatcgctgccaatatcggcaccggt
tatgcggattggtatgcggctgttatcctagaaaaagaaaatggtcgcgccaaaatcggc
tttgaagatggtcaggaagattatctttatccatggggagcagcgatgccgcgccatgat
actgaaacctcggcatggcggtttttgcatgaaggcgatattattattgtcaagaaaatc
gacaatttttggatattacgtagccttcccgctgtttccggcggcatggtggtagaagac
ccccatacaggccgagtcatggcaatgcagggaggatttgactaccggaacggggatttt
aaccgcgccacccaagccgaaagacaaccgggatccacctttaagccttttgtttattcg
gcagctttggatcacggtatgacaccggcctctatcattgttgatggccctttctgcgtc
tatcaatctgctcgtttgggtatgaaatgtttccgtaacttttccggtggttattcgggc
ccccagacaatgcgttggggcgttgagcaatcccgaaatttgatgacggtgagagcggcc
gcccagacaggaatggcgcatgtcgtcaaaatggccgaaaaagccgagatcaatccgccg
gggcatccttatcctccggtattgggcatcgctttgggcgcgggtaataccactgttatg
cgcctcaccaatggttattcgatgttagccaatcaagggcggcgcttgcatcccagtttg
attgattatgtccaagatcggaatgggaaggttatttataaatcggatgaccggatatgc
agcggatgcaatctgccagaatgggatggtcaacccatgccgaggccgcatcataccaat
gggcaggcgatcaatgcgatgacggcttatcagatgctgcatattttagaaggggttgtt
caacgaggaactgccgcgatcttgcgtgatttgggccgccccatgtttggtaagactggc
acctcgacagggccgaccaatgtctggtttgttggcggatctgcggatttggtcgcaggg
ctttatgtcggttatgatcgtccccgttcgatgggacatagcgcccaagggggcactgtg
gctgccccgatttttaaacaatttgcccagcgcagtatgacagagatgcctgtgaaacct
tttccggtagcacctgatattcatatggtaaaaatagatcgctattcaggtttgcggatc
tatggttctgcgcccgtcaatcctgccgatccgatgagtccgattatatgggaggctttt
aaacccgataatgagccgcgtcggagtttctatcgacctgcggttgttgcggcagccgtt
acgcctgtttccaataatgcgaccgatgacagccataaaagtgaggctgccaaagctcag
cctgtggctcctcctgttaatcttccgcatccaaatgatcgcagtagcttgcagaagtga

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0499
Entry
ZMO0499           CDS       T00221                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00550  Peptidoglycan biosynthesis
zmo01100  Metabolic pathways
zmo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO0499
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ZMO0499
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:zmo01003]
    ZMO0499
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO0499
Enzymes [BR:zmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ZMO0499
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ZMO0499
Glycosyltransferases [BR:zmo01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   ZMO0499
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   ZMO0499
SSDB
Motif
Pfam: Transgly Transpeptidase DUF6479 DUF6296
Other DBs
NCBI-ProteinID: AAV89123
UniProt: Q5NQ82
Position
complement(497670..499778)
AA seq 702 aa
MSRKPSKNPQNRPQRKALRLVLIVGGILATIILVLAVLLGIAVYTTKSSLPDFDKLKASP
NGQTIRVHSNDGTVIVNMGPGYGRWIPYNDIPKSMTQAMIATEDRRFRYHIGVDPVGMMR
AVGVAIIHHGQGKRWQGASTITQQLARNVFLTNNYSFARKAREALLALAIEQKFTKNQIL
ELYLNRVYFGGGAYGIDAASRKFYGHPATQLSLPEAAIIAGLVKAPSNYSPTADPEAAVS
RGRVVLGLMAEQHLINPTEQINADPQNVALSAEPHQNGVRYFTDWALAQLDSLIEPSTEP
IDVWTTLDLGMQRAADTTIQDSTPKGAQGALVTLDSDGAVRAMVGGRDYVSSIYNRATQA
TRQPGSSFKLFVYLAALESGVRPDDRIVDEPVTINGWSPRNASRHFSGDISIRTAFAFSL
NTIAAKLGSQVGFNTVATMAKRLGITTPIDVVPSMVLGTSDVRLIDMTRAFAVVARKGIA
VTPYGISRITTSYGKLLYQHPDNSDQVLLAPWVAAEMTDLLQTAVATGTARAAQIGRPVA
GKTGTTSSSHDGWFIGFSSGLTTGVWMGRDDSKPVPGLSGGHAPAMAFSKYMRVAVADRP
VVPFDTQVTLPDSQVEPDDETYFGDAAAIHPATSGLPADTPAPTLPPAVTEKHAGDADDN
RSKGNEKPAIKPDSGKEKSTGHADPALDKNWLDNVLGHNPEG
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgagccgcaaaccttcaaagaaccctcaaaaccgcccccaaagaaaagccttgcgcctt
gtcttgatcgtcggtggcatattggcgacgattatcttggtcttggctgtgcttttggga
atagctgtttacacaaccaaaagtagcctgcctgattttgacaagctgaaggcttctccc
aatggtcaaaccattcgggttcactcgaatgacggcacggttatcgttaatatgggtccc
ggctatggccgttggattccgtataatgatatcccgaaatccatgacgcaggcgatgatc
gcaacagaagaccgtcgtttccgttatcatatcggtgtcgatccggtggggatgatgcgg
gctgtcggggtggcgattattcaccatggccaaggcaaacgctggcaaggggcatcgacc
atcacccagcaattagcccgcaatgtcttcctgaccaataattacagctttgcccgtaaa
gcgcgggaagccttgctggcattagcgattgagcaaaaattcactaaaaaccagatttta
gaactttatcttaatcgggtctatttcggtggtggtgcttacggaattgatgcagcttcc
cgtaaattttacgggcatccggcaacccagctttcacttcccgaagctgctattatcgca
ggtttggtcaaggcaccttccaattattcaccaaccgccgatccagaagccgcagttagc
cgtggacgcgttgttttgggattgatggcagaacagcatctgatcaacccaaccgagcag
atcaatgccgatccgcaaaatgttgctttatcggctgaaccgcatcaaaatggtgtgcgc
tactttacagactgggctttggcacagttggattctctgatcgagcccagcacagaaccg
attgacgtctggacaacgcttgatctcggaatgcaaagagccgcagatacaacgattcaa
gactccaccccgaaaggggcacaaggtgccttggtaacgcttgatagcgatggtgcggtt
cgagccatggttggtggccgcgattatgtttcttctatctataatcgggcaacacaggcg
actcgtcagccaggttcatcctttaaactttttgtttatcttgcggctttggaaagtggg
gttcgccccgatgaccgtattgttgatgaaccagtgaccatcaacggatggagtccgaga
aacgcttcccgtcatttttcgggtgatatcagcattagaacagcttttgccttttctttg
aatacgattgccgccaaacttggcagtcaggtcggctttaacacggtcgccaccatggct
aaaagattaggcatcacaacaccgattgatgttgtgccttcaatggtgctgggaacttcc
gatgtccgtttgattgatatgacccgcgcttttgctgtcgttgccagaaaaggtattgcg
gttaccccttatggtatcagccgtatcacgaccagctatggcaaattgttgtatcagcat
cctgataacagcgatcaggtcttattagccccttgggttgcagcggaaatgactgatttg
ctgcaaacggcagttgccaccggaaccgcacgcgctgcccagataggtcgccctgttgcc
ggtaaaaccggaacgacttcatctagtcatgatggctggttcatcggtttctctagtggt
ctgacaacaggcgtctggatggggcgcgatgattctaaacctgtgccggggttatccggc
ggtcatgctccggccatggcgttctcgaaatatatgcgtgtcgctgtggctgatcggcct
gttgtgccttttgacacacaggtaactttgccagattctcaggttgaaccggatgacgaa
acctatttcggtgatgctgcggctattcatccggcgacttccggtcttccggcggatacc
cccgcgcctactctgccaccagcggtgacagaaaaacacgcaggggatgcggatgacaac
cgttccaagggcaatgaaaaacccgcgataaagccggattctggtaaagaaaaatcaaca
ggacatgccgatccagccttagataaaaactggctcgataatgttctcggccataatcct
gagggttaa

DBGET integrated database retrieval system