KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0322
Entry
ZMO0322           CDS       T00221                                 

Definition
(GenBank) riboflavin biosynthesis protein RibF
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00740  Riboflavin metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ZMO0322
Enzymes [BR:zmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     ZMO0322
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthase
     ZMO0322
SSDB
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AAV88946
UniProt: Q5NQQ8
Position
318729..319673
AA seq 314 aa
MTCLFSDAPIPDHLYGAIVALGNFDGFHLGHQAVVAAAVARGHAEGRPVIVATFDPHPVR
FFCPDLPPFALTTIPQRARLFEKAGADATFVIRFSEAMANLSPEEFIQQQIIDHLKAAGV
VTGRDFTFGKGRKGGVDLLQAMGQNLNISVDTIMPVCDQQGAISSTRIREALKQGDPETA
ARLLSRPFTVEGVVRHGNQVGRQLGFPTANLLMGDYVRPAYGIYAVKGRLPDGRYLDGAA
NLGIRPSFSPPTEWLEPCFFDWEGDIYDQTIAVSLIAFLRPEQKFKGMDALIQQIGEDCK
VARACLSEYVIDPI
NT seq 945 nt   +upstreamnt  +downstreamnt
atgacctgtctttttagtgacgccccgatacccgatcatttatatggcgctattgttgcg
cttggtaattttgacggcttccatttaggccatcaggctgtggtagcggcagcggtagcc
cgtggccatgccgaaggtcgccccgttattgtcgcgacttttgatccgcatcctgtgcgt
tttttctgtcccgatttgccgccctttgctttgacgactatcccgcaacgcgcgcgtttg
tttgaaaaagcgggcgctgatgcgactttcgtcattcgtttttcggaggccatggcgaat
ttaagccccgaagaatttattcaacagcaaattatcgaccatttgaaagcggcaggcgtt
gtcaccggacgtgattttacctttggtaaagggcgaaaaggcggcgttgatttgttgcag
gcgatgggacagaatttaaatatttctgtcgatactattatgcctgtttgtgatcagcag
ggcgctatttcctctacccgtattcgagaggctttgaagcagggcgatcccgaaacggca
gcccgtcttcttagtcggccttttacggtcgaaggcgttgtccgtcatggaaatcaggtg
ggtcgtcaactgggattcccaacggccaatctattgatgggtgattatgttcggcctgct
tatggtatctatgcggtgaaggggcggttgcccgatggacgctatcttgatggcgccgct
aatttagggatacgtcccagtttttctccgccaacagaatggctggagccttgttttttt
gactgggaaggcgatatctacgatcagacgattgccgtttccttgattgcttttttacgg
ccagagcaaaaatttaagggtatggatgccttgattcagcaaataggcgaggattgtaag
gttgcccgcgcctgtttaagcgaatatgtcattgatcctatctaa

DBGET integrated database retrieval system