KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0359
Entry
ZMO0359           CDS       T00221                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00550  Peptidoglycan biosynthesis
zmo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO0359
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ZMO0359
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO0359
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ZMO0359
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ZMO0359
SSDB
Motif
Pfam: Transpeptidase PBP_dimer
Other DBs
NCBI-ProteinID: AAV88983
UniProt: Q5NQM1
Position
357765..359696
AA seq 643 aa
MKKRSHLITQHSLGYSFSRRAMLFGGLQLATGSLLAMRMAWLSVAENEHYSLMAEDNRVQ
TVLIPPRRGWIVDRHNRPMAINHTDFRVDIIPDQIQDRERVIITLAELLNLSPDDVDRIR
EDLNKAAGYQPVPIAEHLDYEHFAAISVRLPEMAGVAPQRSYARYYPNGSAVGHLIGYVG
AATTDDYKKNHDPLLITPGFKIGKQGLEKTFDNYLRGVPGAKRSEVTARGRLVRDLENKP
DQPGKKLPLTIDAGLQDYAARRIGDNSAAVVVIDTENGDILAQVSMPCFDPNDFADGISH
REWQSLSQDDHHPLIDKTIAGLYPPGSTVKPMNALALLELGIDPYETVNCTGSYQLGSSL
FHCWRRQGHGPVNMHTAITQSCDVYFYAMAHRVGMEPLADMMRQLGLGASYHLPLGSEHY
GTVPDPAWKLKKYHRNWTAADTLNASIGQGDVLANPLQLAVMAARLASGKQITPRLIRSK
EVPMPAKLNAKESHLDFIRQAMRDVVNGGGTGGAARLYVPGVELAGKTGTAQVRRISMAE
RGRGVLKNSQLAWRMRDHALFVCFAPTDNPRYAASVVVEHGGHIDSATDGPAIARDVLTY
LFDPDRAMASLNALEVSWGGDLASRMRMRSENASKAPSKPNMT
NT seq 1932 nt   +upstreamnt  +downstreamnt
gtgaaaaagcgtagtcatcttattacccaacattcgctcggctatagtttttcccgccgt
gctatgctttttggcggattgcaattggcaaccggcagtttgttggccatgcggatggct
tggctatctgtcgcggaaaacgaacattatagtctaatggctgaagataatcgggtgcag
actgtcttgataccgccaagacggggatggattgttgatcgtcataatcggccaatggcg
atcaatcatactgattttcgtgtcgatattattcccgatcaaatacaggatcgggaacgg
gtaattattactttggccgagctactcaatctctctccagatgatgtcgatcggattcgg
gaagatttgaataaagccgccggttatcagcctgtcccgattgccgagcatcttgattac
gagcattttgctgcgatctctgtccgtttgcctgaaatggccggagtagcgccacaaaga
agttatgcccgttattatccaaatggctctgcagtcggacatttaatcggttatgtcggc
gcagcgacaactgatgattataagaaaaatcacgatcctttgttaattacacccggattt
aaaattgggaaacaagggttagaaaaaacttttgataattatctaagaggggttccgggt
gctaagcgttccgaagtgacggcgcgcggacggttagtgcgtgatctggagaataagcct
gatcagcccggtaaaaagctgcctttaacaattgatgctggtttacaggattatgcggcg
cggcgcattggagataacagcgcagccgttgttgtgattgataccgaaaatggggatatt
ttggcgcaagtatccatgccctgttttgatcccaatgattttgccgatggtatcagtcat
cgagaatggcaaagtctgtctcaagatgatcatcatcccttgatcgataaaacgattgcg
ggtctttatccccccggctcgacagtcaagccgatgaatgcgctggctttgctggaattg
ggcattgatccttatgaaacggtcaattgcactggcagttatcaattgggcagtagttta
tttcattgttggcggcggcaaggtcatggccccgtcaatatgcatacggcaatcacgcaa
agttgtgacgtctatttttacgctatggcgcatcgggttggtatggagcctttggccgat
atgatgcgtcaattaggactgggtgctagttaccatctgcctttgggatcagaacattat
ggcacggttcctgaccctgcatggaaattgaaaaaatatcatcgcaattggacggcggca
gatactttgaatgcctcgatcgggcagggggatgttttggccaacccgttgcaattggct
gtgatggcggcgcgattggcttcgggaaaacagattacgcctcggctgatccgctcaaaa
gaagtccctatgcccgccaaattgaacgccaaagaatcccatcttgattttattcggcag
gccatgcgggatgtggtgaatgggggaggcaccggtggtgctgcaagattatatgttccc
ggtgttgaattggcggggaaaaccggaacggcgcaggttcggcgtatttcaatggctgaa
cgtgggcgcggtgtgttgaaaaattcacaattggcttggcggatgcgcgatcatgccttg
tttgtttgctttgcaccgacagataacccacgttatgccgcctcggttgttgtcgaacat
ggtggacatattgactccgctacggatggaccggctattgcacgcgatgtcctgacctat
ttgtttgatcccgatcgtgctatggccagtttgaacgctttggaagtgtcgtggggtggg
gatcttgcgagccgtatgcgtatgcggtcggaaaatgcctcgaaagctccatctaaaccc
aatatgacttag

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0825
Entry
ZMO0825           CDS       T00221                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00550  Peptidoglycan biosynthesis
zmo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO0825
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ZMO0825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO0825
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:zmo03036]
    ZMO0825
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ZMO0825
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ZMO0825
Chromosome and associated proteins [BR:zmo03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    ZMO0825
SSDB
Motif
Pfam: Transpeptidase PBP_dimer PolyA_pol_RNAbd
Other DBs
NCBI-ProteinID: AAV89449
UniProt: Q5NPB1
Position
826405..828120
AA seq 571 aa
MSTRIKSQKKKALSSVADILTTSHIRLMVLLILFCCGIAAVIAKLIWLIFITGWGVEERR
HPPVAPLQARADIVDRNGRTLARTIDVWSIGIHPRTLQANHISDPDILAANLAALLPERT
ADEYRKILHSNRSFVFLRRHASPELVRALNMLGEPAIDFLHEPSRLYPEGNLCAHVIGWI
GEDGHGQSGMEYSFDKELTDPKRQSEPLALSIDIRVQAAVEKSLAAAMQKYSAVGASAIV
LDVDTGEVLAMASLPNFNPNDRSSSDPTAFDNKATLSVYELGSTFKPLTMATAIQDGVVT
SLAKRYDATEPLAVGRFHIHDEHAQKRWLDVPETLVHSSNIVTARIADELGPERMQAMFR
NLNFDHRPAIELAAKGRPIWPAFWARTTVMTTGYGHGIAVTPLHLTSAYAAIVNGGIWRP
ATLLKRNPDYRPDGSRQIISGQTSATMRRLLRLIVTDGTGRKANVEGFRVGGKTGTADKA
EKGRYNHGARISTFAAVFPMDTPRYAIVAMLDNPQGTAETGGYATAGMVTAPMVGDIIQH
IGPLLGVIPDPKRDLDLTDLRALLWKPPAKQ
NT seq 1716 nt   +upstreamnt  +downstreamnt
gtgagcacccgcattaagtctcaaaaaaagaaggccttatcatctgtcgctgatattctg
accacaagccatattcggcttatggtcttgcttattcttttttgctgcggcattgctgcg
gttattgccaagctgatatggcttatctttattaccggttggggggtggaagagcgccgc
catccacccgttgcgccgttgcaggcgcgcgccgatatcgttgatcgtaacggtcggaca
ttggcgcgcacgattgatgtttggtctatcgggatacatccccgcacgttacaggccaat
catatcagcgaccccgatattctggcggctaatctggcggctttgctgcctgaacggacg
gctgatgaatatcggaagattttacattccaatcgtagctttgtttttttgcgtcgccat
gcctcgccggaattagtgcgcgctttgaatatgctgggtgaaccagcaattgatttcttg
catgagccttcgcgattatatccagaaggtaacttatgcgcccatgttatcggctggatc
ggtgaagatggtcatggccagtccggcatggaatacagttttgacaaggaattgaccgac
ccgaaaagacaatccgagcctttggcgctttctattgatattcgggttcaggccgccgtt
gaaaaatcattggctgcagccatgcaaaaatatagcgcggtgggtgccagtgccattgtt
ttggatgtcgataccggtgaagttttagcgatggcatccttgcccaattttaatccgaat
gaccggagtagttctgacccgactgcttttgacaataaagcgacgctttctgtgtatgaa
ttgggatcgacctttaagcctttgaccatggcaactgctattcaagatggcgtcgtaacc
tctttggcaaaacggtatgatgcaaccgagcctttggcggtgggtcgtttccatatccat
gatgagcatgcccagaaaagatggctagatgtgcctgaaacgcttgtgcattcttccaat
attgtgactgcccgtattgctgatgaattgggcccagaaagaatgcaggcgatgttccgg
aatcttaatttcgatcatcgtccggctatcgaactggcagctaaaggtcgtccgatctgg
cctgctttttgggcaagaacaacggttatgacgactggatatggtcatggtattgcggtt
acgcctttacatttaaccagtgcttatgccgcgattgtgaatggcggcatttggcgacca
gccactttgttgaagcgtaatcccgattatcgtcccgatggcagccgccagattatttcg
ggtcagaccagtgcgactatgcggcggttattgcgcctgattgtgacagatggaaccgga
cgtaaggccaatgttgaaggttttcgggttggcggcaagaccggaacggcagataaagcc
gagaaaggccgttataatcatggtgcgcgtatttcgacttttgcagccgttttccctatg
gatacaccgcgttacgctattgttgccatgttggataacccgcaagggacggctgaaacc
ggaggttatgccaccgccggtatggtaacggcgccaatggtcggggatattattcagcat
ataggcccgttgctgggggttattcctgatccgaaacgcgatcttgatcttaccgattta
cgggctttgttatggaaaccaccggcgaaacaataa

DBGET integrated database retrieval system