KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0369
Entry
ZMO0369           CDS       T00221                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00052  Galactose metabolism
zmo00500  Starch and sucrose metabolism
zmo00520  Amino sugar and nucleotide sugar metabolism
zmo00521  Streptomycin biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
Module
zmo_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0369
   00052 Galactose metabolism
    ZMO0369
   00500 Starch and sucrose metabolism
    ZMO0369
   00520 Amino sugar and nucleotide sugar metabolism
    ZMO0369
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ZMO0369
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ZMO0369
Enzymes [BR:zmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ZMO0369
SSDB
Motif
Pfam: Glucokinase ROK Harpin
Other DBs
NCBI-ProteinID: AAV88993
UniProt: P21908
Position
373654..374628
AA seq 324 aa
MEIVAIDIGGTHARFSIAEVSNGRVLSLGEETTFKTAEHASLQLAWERFGEKLGRPLPRA
AAIAWAGPVHGEVLKLTNNPWVLRPATLNEKLDIDTHVLINDFGAVAHAVAHMDSSYLDH
ICGPDEALPSDGVITILGPGTGLGVAHLLRTEGRYFVIETEGGHIDFAPLDRLEDKILAR
LRERFRRVSIERIISGPGLGNIYEALAAIEGVPFSLLDDIKLWQMALEGKDNLAEAALDR
FCLSLGAIAGDLALAQGATSVVIGGGVGLRIASHLPESGFRQRFVSKGRFERVMSKIPVK
LITYPQPGLLGAAAAYANKYSEVE
NT seq 975 nt   +upstreamnt  +downstreamnt
atggaaattgttgcgattgacatcggtggaacgcatgcgcgtttctctattgcggaagta
agcaatggtcgggttctttctcttggagaagaaacgacttttaaaacggcagaacatgct
agcttacagttagcttgggaacgtttcggtgaaaaactgggtcgtcctctgccacgtgcc
gcagctattgcatgggctggcccggttcatggtgaagttttaaaacttaccaataaccct
tgggtattaagaccagctactctgaatgaaaagctggacatcgatacgcatgttctgatc
aatgacttcggtgcggttgcccacgcggttgcgcatatggattcttcttatctggatcat
atttgtggtcctgatgaagcgcttcctagcgatggtgttatcactattcttggtccggga
acgggcttgggtgttgcccatctgttgcggactgaaggccgttatttcgtcatcgaaact
gaaggcggtcatatcgactttgctccgcttgacagacttgaagacaaaattctggcacgt
ttacgtgaacgtttccgccgcgtttctatcgaacgcattatttctggcccgggtcttggt
aatatctacgaagcactggctgccattgaaggcgttccgttcagcttgctggatgatatt
aaattatggcagatggctttggaaggtaaagacaaccttgctgaagccgctttggatcgc
ttctgcttgagccttggcgctatcgctggtgatcttgctttggcacagggtgcaaccagt
gttgttattggcggtggtgtcggtcttcgtatcgcttcccatttgccggaatctggcttc
cgtcagcgctttgtttcaaaaggacgctttgaacgcgtcatgtccaagattccggttaag
ttgattacttatccgcagcctggactgctgggtgcggcagctgcctatgccaacaaatat
tctgaagttgaataa

DBGET integrated database retrieval system