KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0465
Entry
ZMO0465           CDS       T00221                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00051  Fructose and mannose metabolism
zmo00562  Inositol phosphate metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
zmo01230  Biosynthesis of amino acids
Module
zmo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0465
   00051 Fructose and mannose metabolism
    ZMO0465
   00562 Inositol phosphate metabolism
    ZMO0465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zmo04147]
    ZMO0465
Enzymes [BR:zmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ZMO0465
Exosome [BR:zmo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ZMO0465
  Exosomal proteins of bladder cancer cells
   ZMO0465
  Exosomal proteins of melanoma cells
   ZMO0465
SSDB
Motif
Pfam: TIM
Other DBs
NCBI-ProteinID: AAV89089
UniProt: Q5NQB6
Position
complement(457462..458211)
AA seq 249 aa
MTIRKLIAGNWKMNGSLGMLHELDGIAKATFNHPELDVVICPSFTLIAPAIVRQPDMTFG
AQDCHYDESGSHTGCVSAPMLREVGASYVIVGHSERRIEQNETNEEIRAKTTTAIANGLV
TIVCIGESRAAHASGQALPIIGAQLDGCIPPDATSDNLVVAYEPIWAIGTGNTPPPESIA
EMHASIRDRLCLLLGSEGKKVRILYGGSVTGKNAEELMAIPDVNGTLVGGASLTAEQFVP
IIEAGGRLA
NT seq 750 nt   +upstreamnt  +downstreamnt
atgacaatacgcaagctcatcgccggcaattggaaaatgaacggttctttaggcatgttg
cacgaactggacgggatcgccaaggcaacctttaaccatccagaacttgatgtcgtgatt
tgtccatccttcacgctgatagcgcccgctattgtgcggcaacccgatatgaccttcggg
gcgcaagattgccattatgatgaaagtggttcgcataccggctgtgtttcggcaccgatg
ctccgtgaggtcggtgcaagttatgtcatcgttggccatagcgaaagacgtattgaacag
aatgaaaccaatgaagagatccgagcaaaaacgacaacggcgatagccaatggccttgtg
acgattgtctgtattggcgaatcccgtgctgcccacgcatcggggcaggctttgcctatt
atcggggcgcagctggatggctgtattccgcccgatgccaccagcgataatctcgttgtt
gcctatgaacccatctgggctatcggaacgggtaataccccaccgcctgaaagcattgcc
gaaatgcacgcctcgattcgtgaccgcttgtgcttgttattaggaagcgaagggaagaag
gtccgcatcttatatggaggctctgttaccggcaaaaatgccgaagaattgatggccatt
ccagatgtcaatggaacccttgtcggtggtgccagccttaccgcagaacaatttgttcct
atcattgaagctgggggacgtttagcctag

DBGET integrated database retrieval system