KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0473
Entry
ZMO0473           CDS       T00221                                 

Definition
(GenBank) 6,7-dimethyl-8-ribityllumazine synthase
  KO
K00794  6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00740  Riboflavin metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ZMO0473
Enzymes [BR:zmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     ZMO0473
SSDB
Motif
Pfam: DMRL_synthase
Other DBs
NCBI-ProteinID: AAV89097
UniProt: Q5NQA8
Position
complement(464614..465033)
AA seq 139 aa
MAKFLIVEARFYSHLNDMLIQGAKQAIEEAGHECEVITVPGALEIPAAITMASDTGLYDA
FVALGVVIRGETYHFEIVASESARGVMALTLDGLVIGNGILTVENEQQALVRADPQQKNK
GGDAAKAAITMFNLKKKLS
NT seq 420 nt   +upstreamnt  +downstreamnt
atggctaaattcttaattgtcgaagcacgtttctatagccatttgaatgatatgctgatt
caaggtgccaaacaggccattgaagaagctggtcacgaatgtgaagtcattacggtgcca
ggcgcgctcgaaattccggcagccattactatggcatctgataccggcctttatgatgcc
tttgtcgctttaggcgtggttattcggggcgaaacctatcatttcgagatcgtagcgtca
gaaagcgcccgtggcgttatggctttgactttagatggtttagtgatcggtaacggtatt
ttgaccgtcgaaaatgaacagcaggccttggttcgcgctgatcctcaacaaaaaaacaag
ggtggtgatgcggccaaggcggctattaccatgttcaatctcaagaaaaaattatcttaa

DBGET integrated database retrieval system