KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0474
Entry
ZMO0474           CDS       T00221                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00740  Riboflavin metabolism
zmo00790  Folate biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ZMO0474
   00790 Folate biosynthesis
    ZMO0474
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     ZMO0474
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     ZMO0474
SSDB
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Other DBs
NCBI-ProteinID: AAV89098
UniProt: Q5NQA7
Position
complement(465035..466174)
AA seq 379 aa
MSKNTPIVKGSTKRHPFLSSVEELIEEARNGRIFILVDDEDRENEGDLIIPAQMATPAAI
NFMATHGRGLVCLAMTKERVTSLGLAPMSRENNAPLQTAFTVSIEAKEGVTTGISAGDRA
RTIAVAIDSSRGAEDIVTPGHVFPLAAKSGGVLVRAGHTEAAVDIARLAGLNASGVICEV
MKEDGTMARLDDLVTFAQRHNIKIGTIRDLIAWRREHDNNVELIEEKSFNSLYGGDWQAI
RFRNKATGSESLALVKGQISADEPTLVRMHAIDPFTDMLGQTGSRQQLLSRSMEIIAKKG
AGVVVLVQRSQENSADKSSVWAASRNQETIHRDYGIGAQILAELGVRDMILLTNSHHMPV
ALAGYGLNITGEQPITEGA
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgagtaagaacacccctattgtaaaaggatcgaccaaacggcatccttttctatcttcg
gttgaagagcttatcgaagaagcacggaatggccgaatatttattctggttgatgatgaa
gatcgtgaaaatgaaggcgatctgattattccggcacagatggcaacaccggcggccatc
aattttatggcgacgcatggacgaggattggtctgcctcgccatgaccaaagaacgcgta
accagtttgggtctagccccgatgtcacgcgagaataacgcgcctctgcaaacggctttc
accgtttcgattgaagccaaagaaggcgttacaacaggcatttctgctggcgacagggca
agaaccattgcagttgctatcgacagttctcggggtgcagaagacatcgtaaccccgggt
catgttttccccttagcagcaaaatcgggcggtgttctggtcagggcgggacatacggaa
gccgctgttgatattgcacgtttggctggattaaatgcttccggtgttatctgtgaagtg
atgaaagaagacgggacaatggctcgtcttgatgatctggtcacttttgctcaaagacat
aatatcaagataggcaccatccgcgatttgatcgcatggcggcgtgaacatgataataat
gtcgagttgatagaagaaaaatctttcaacagcctttatggcggtgattggcaagccatc
cgtttcagaaacaaagcgaccggcagcgaatccttggccttggtcaaagggcagatttca
gctgatgaaccgacccttgttcggatgcatgccattgatccttttacggatatgctgggt
caaacaggctctcggcagcagcttttatcccgttcgatggaaatcattgcaaagaaagga
gctggtgtcgttgttcttgttcaacgttcacaggaaaatagtgccgataaaagctctgta
tgggctgccagccgaaatcaggaaacgattcaccgcgattatggtataggcgcacaaatt
ctggcggaattgggggtcagagatatgattcttctgacgaacagccaccatatgcctgta
gccttggccggatatggccttaacataacgggcgaacagcctattaccgaaggagcctga

DBGET integrated database retrieval system