KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0474
Entry
ZMO0474           CDS       T00221                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00740  Riboflavin metabolism
zmo00790  Folate biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ZMO0474
   00790 Folate biosynthesis
    ZMO0474
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     ZMO0474
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     ZMO0474
SSDB
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Other DBs
NCBI-ProteinID: AAV89098
UniProt: Q5NQA7
Position
complement(465035..466174)
AA seq 379 aa
MSKNTPIVKGSTKRHPFLSSVEELIEEARNGRIFILVDDEDRENEGDLIIPAQMATPAAI
NFMATHGRGLVCLAMTKERVTSLGLAPMSRENNAPLQTAFTVSIEAKEGVTTGISAGDRA
RTIAVAIDSSRGAEDIVTPGHVFPLAAKSGGVLVRAGHTEAAVDIARLAGLNASGVICEV
MKEDGTMARLDDLVTFAQRHNIKIGTIRDLIAWRREHDNNVELIEEKSFNSLYGGDWQAI
RFRNKATGSESLALVKGQISADEPTLVRMHAIDPFTDMLGQTGSRQQLLSRSMEIIAKKG
AGVVVLVQRSQENSADKSSVWAASRNQETIHRDYGIGAQILAELGVRDMILLTNSHHMPV
ALAGYGLNITGEQPITEGA
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgagtaagaacacccctattgtaaaaggatcgaccaaacggcatccttttctatcttcg
gttgaagagcttatcgaagaagcacggaatggccgaatatttattctggttgatgatgaa
gatcgtgaaaatgaaggcgatctgattattccggcacagatggcaacaccggcggccatc
aattttatggcgacgcatggacgaggattggtctgcctcgccatgaccaaagaacgcgta
accagtttgggtctagccccgatgtcacgcgagaataacgcgcctctgcaaacggctttc
accgtttcgattgaagccaaagaaggcgttacaacaggcatttctgctggcgacagggca
agaaccattgcagttgctatcgacagttctcggggtgcagaagacatcgtaaccccgggt
catgttttccccttagcagcaaaatcgggcggtgttctggtcagggcgggacatacggaa
gccgctgttgatattgcacgtttggctggattaaatgcttccggtgttatctgtgaagtg
atgaaagaagacgggacaatggctcgtcttgatgatctggtcacttttgctcaaagacat
aatatcaagataggcaccatccgcgatttgatcgcatggcggcgtgaacatgataataat
gtcgagttgatagaagaaaaatctttcaacagcctttatggcggtgattggcaagccatc
cgtttcagaaacaaagcgaccggcagcgaatccttggccttggtcaaagggcagatttca
gctgatgaaccgacccttgttcggatgcatgccattgatccttttacggatatgctgggt
caaacaggctctcggcagcagcttttatcccgttcgatggaaatcattgcaaagaaagga
gctggtgtcgttgttcttgttcaacgttcacaggaaaatagtgccgataaaagctctgta
tgggctgccagccgaaatcaggaaacgattcaccgcgattatggtataggcgcacaaatt
ctggcggaattgggggtcagagatatgattcttctgacgaacagccaccatatgcctgta
gccttggccggatatggccttaacataacgggcgaacagcctattaccgaaggagcctga

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1698
Entry
ZMO1698           CDS       T00221                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00740  Riboflavin metabolism
zmo00790  Folate biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01240  Biosynthesis of cofactors
zmo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ZMO1698
   00790 Folate biosynthesis
    ZMO1698
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ZMO1698
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     ZMO1698
SSDB
Motif
Pfam: GTP_cyclohydro2
Other DBs
NCBI-ProteinID: AAV90322
UniProt: Q5NLT8
Position
complement(1746875..1747969)
AA seq 364 aa
MVEDRKAIVIAQAIDALRRGWPISISDQGEILSLLAVERADDHRLKVFDPDQTADILLSA
ARAAILNLANDKEAATPDQPVTLVRTPWIDCASALALADPSMDLEMPMKGPFKVKKTVIK
SAAASALELARMAGLLPAFFVQEGQSEQSLLTIPAQDIVDFFQGQGVYIAARARLPIALG
DHGKAIENSQIVAFRNDADAVEHVAVIIGHPDGQPPVVRLHSECLTGDVFGSLKCDCGPQ
LHQALRIMDESGYGILLYLRQEGRGIGLINKLRAYSLQDQGFDTVDANVRLGFVNDARDF
RLAAQMLGELEIKQIRLLTNNPDKVEGLKKAGIDVVERLPLKIKPNPHNQAYLETKRDRS
GHQL
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggttgaggatcgtaaagcgatagtcatagcacaggcgatagatgccttgcggcggggt
tggccgatttcgatctctgatcagggcgagattctaagcctgttggcggtcgaacgtgct
gacgaccatcggctcaaggtctttgatcccgatcagacagccgatattttactgtctgcg
gcaagagcggctatcttgaatctcgccaatgacaaagaggctgctactcccgatcaacct
gtcaccttggtaaggacgccttggatagattgtgcttctgccttggccttggctgatcct
tctatggatcttgaaatgccgatgaaggggccttttaaggttaaaaaaaccgttattaaa
tcggcagccgcatcggctttggaattggccagaatggcaggattacttccggctttcttc
gttcaagaagggcagtccgagcaatccctcttgactattcctgcacaagatattgtcgat
ttcttccaagggcagggggtttacatcgccgcaagggcgcggttgccgattgccttgggc
gatcatggtaaagccattgaaaacagccagatcgttgcgttcagaaatgatgccgatgcc
gtagagcatgttgcggtgattatcggtcatcctgatggtcaaccacccgttgttcgattg
catagcgaatgtcttaccggcgatgtgtttggttcgctgaaatgtgattgtggcccccag
ctacatcaggctttaaggattatggatgaatccggctatggcatcctgctttatttgcga
caggaagggcgtggtattgggctgatcaataaattgcgtgcctatagcttgcaagatcag
ggttttgatacagtagatgccaatgtccgcttgggctttgtcaatgatgcccgcgatttc
cggctggctgcccagatgctaggtgaattggaaataaagcaaatccgtttgctgaccaat
aatcctgacaaagtagaagggcttaaaaaagccggcattgatgttgtcgagcggttaccc
ttaaagatcaagccgaacccgcataatcaggcgtatcttgaaaccaagcgagaccgtagc
ggccaccaattataa

DBGET integrated database retrieval system