KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0475
Entry
ZMO0475           CDS       T00221                                 

Definition
(GenBank) riboflavin synthase, alpha subunit
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00740  Riboflavin metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ZMO0475
Enzymes [BR:zmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     ZMO0475
SSDB
Motif
Pfam: Lum_binding
Other DBs
NCBI-ProteinID: AAV89099
UniProt: Q5NQA6
Position
complement(466171..466791)
AA seq 206 aa
MFTGIVTDIGEITSVTQEGDRRIRIATEYPMDTVPTGSSIACSGVCLTVVDKGTTPRNWF
EVTVSGESVSRTAPGRWEKGQKLNLERALKIGDELGGHIVTGHVDGIGKVVSITAVGDSH
NFLIEAGPEVAPHIAEKGSVSLDGVSLTVNEVKDVDGKVLFSINIIPHTAEKTTLGDLKA
GDFVNIEIDVLSRYLARMNALGNVAV
NT seq 621 nt   +upstreamnt  +downstreamnt
atgttcaccggcattgttaccgatattggcgagattacttctgttacgcaggaaggcgat
cgccgcattcgtattgcgacagaatatcctatggataccgttcctaccggttcctctatc
gcctgttccggtgtttgtctgaccgtggttgacaaagggacaacgcctcgcaactggttt
gaggttaccgtttctggcgaatctgtttcccgcacggcaccgggacgctgggaaaaaggc
caaaaacttaatctggagcgtgccttaaaaataggcgatgaattgggcggccatatcgtt
acaggtcatgtcgatggcattggtaaagttgtttcgattacggcggtcggtgactctcat
aattttctgattgaagctggccccgaagtcgccccgcatattgcagaaaaaggatcagtc
tctctcgacggcgtatcacttacggtgaacgaagttaaagatgtcgatggcaaagtactg
ttttctatcaacatcattcctcacaccgccgaaaaaaccacgctgggcgatctgaaagcc
ggtgattttgtcaatatcgaaattgatgttctctcgcgctatcttgccagaatgaatgct
ttaggaaatgtcgcggtatga

DBGET integrated database retrieval system