KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0476
Entry
ZMO0476           CDS       T00221                                 

Definition
(GenBank) riboflavin biosynthesis protein RibD
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00740  Riboflavin metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01240  Biosynthesis of cofactors
zmo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ZMO0476
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ZMO0476
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     ZMO0476
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     ZMO0476
SSDB
Motif
Pfam: RibD_C dCMP_cyt_deam_1 MafB19-deam Inv-AAD APOBEC_N
Other DBs
NCBI-ProteinID: AAV89100
UniProt: Q5NQA5
Position
complement(466880..467851)
AA seq 323 aa
MTHLENDIRWMQAAIALGERSKGLTAPSPSVGCIIVNKDNQIIGRGWTQSGGRPHAEAMA
LSQCQSLKGATVYVTLEPCAHKSNRGPTCSDSLVAAQPERVVIACRDPDPRTNGQGISKM
VAAGIKVECGLLEKQAAQSMSGFFSRQLKARPYVTLKMATSLDGCIALENGESQWITGER
ARAHAHLERMRSELIVVGRKTLEFDKPSLNVRLQGLGDRSPKKAVLGHGEIPSGWIGLRE
PTDIIKTTADHVLIEGGAKTAAAFLKGDLVDRILLYRAPILIGKGLHALADIGLTHLSEA
HHRWHLKERRTLGNDQLEAYLRI
NT seq 972 nt   +upstreamnt  +downstreamnt
ttgacccatcttgaaaatgatatccgctggatgcaagccgccatcgcccttggcgaaaga
agtaaaggcctgactgctccctcgccttctgttggctgtattattgtcaataaagataat
cagataatcggacgtggctggacacagtcaggcggacgacctcatgcggaggcgatggct
ttatcacaatgccaatcgctgaagggggcgactgtttatgtcaccttggagccttgcgcc
cataaaagtaacaggggcccaacctgtagcgatagtttggttgccgctcagcctgaaaga
gtagttattgcttgtcgtgaccccgacccccgaaccaacggccaaggtatttccaaaatg
gtcgcagccggtatcaaagtggagtgtggtcttcttgagaagcaggcggcgcaatccatg
tctggttttttcagtcgtcaactgaaagctcggccttatgttacgttaaagatggcgact
tcgcttgatggttgtatcgcgttagaaaatggcgaaagccagtggattaccggagaaagg
gcgagagcgcatgcccatttggaaagaatgcgatcagagctgattgttgtcggtcgaaaa
acactggaatttgacaaaccctctctcaatgtccgcttacaaggtttaggcgatcgctca
ccgaaaaaagcagttttaggccatggagaaatcccttccggctggattggattaagagag
cccacagatattatcaaaacaactgccgatcatgtcctgattgaaggcggggcaaagaca
gccgcggcttttttaaagggcgatctggttgatcggatattactctatcgcgcccctatt
cttattgggaagggcttgcatgccttggctgatattggattaacgcatttatctgaagcg
catcatcgttggcatctcaaagagagaagaacgcttggcaatgaccagttggaagcctat
ttacgaatataa

DBGET integrated database retrieval system