KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0482
Entry
ZMO0482           CDS       T00221                                 

Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K11532  fructose-1,6-bisphosphatase II / sedoheptulose-1,7-bisphosphatase [EC:3.1.3.11 3.1.3.37]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00030  Pentose phosphate pathway
zmo00051  Fructose and mannose metabolism
zmo00680  Methane metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0482
   00030 Pentose phosphate pathway
    ZMO0482
   00051 Fructose and mannose metabolism
    ZMO0482
  09102 Energy metabolism
   00680 Methane metabolism
    ZMO0482
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     ZMO0482
    3.1.3.37  sedoheptulose-bisphosphatase
     ZMO0482
SSDB
Motif
Pfam: FBPase_glpX
Other DBs
NCBI-ProteinID: AAV89106
UniProt: Q5NQ99
Position
complement(473329..474327)
AA seq 332 aa
MARQESERLNPALTHDMAYVTQSAALAVSRLVGHGNEKAADAAAVKAMRDAFNELSINGT
VVIGEGERDQAPMLYIGEEVGRMGADDISIDIALDPLEGTTLAANGSANAIAVLAIAPKG
SLLNAPDVYMEKVAIGPGYEAGLVSVEKTPIENIQALAKAKGVEPKDIRVCILERQRHQK
IISELHGIGCSTILIEDGDIAGVIATARESSNVDIYMGIGGAPEGVLAAAALNCIGGQFE
GRLLFRNDDERDRAHRCGIEDLNRVYKLHDLAKSDTIFAATGVTDGSLIRGVYKDLRGVS
VTQSLIMQASTGQVSYITTEHRHIPDLATFMK
NT seq 999 nt   +upstreamnt  +downstreamnt
atggctagacaagagagtgaaagactaaaccctgctctgacgcatgacatggcctatgtt
actcaatcggcggctttggccgtctctcgattggtaggacatgggaatgaaaaagccgca
gatgcagcggctgtcaaagccatgagagatgcctttaacgaattgtcgattaacggaacc
gttgttatcggagaaggtgaacgagatcaggcgccgatgctttatatcggcgaagaagtt
ggccgaatgggtgccgatgatatctcaattgatattgctttagatcccttggaaggcaca
accttagccgccaatggcagcgccaatgccattgctgttttagcaattgcccccaaggga
agtcttttaaacgcccctgatgtttatatggaaaaggtcgctataggccccggatatgaa
gccggtttggtcagcgttgaaaagacccccatagaaaatatacaggccttggctaaagcg
aaaggggtcgaacctaaagacattcgggtttgcatcctagaacgccaacgtcaccaaaaa
atcatttcagaattacacggaatcggttgttcaacgattcttatcgaagatggcgatatt
gcgggggtcatcgcaacagcccgcgaaagcagcaatgttgatatatatatgggcattggt
ggtgcgcctgaaggcgtccttgccgccgctgccttgaactgtatcggtggacaatttgaa
ggccgtctcctttttcggaatgatgacgaacgggacagagcgcatcgctgtgggatagaa
gacctcaatcgtgtttataagctgcatgaccttgcaaaaagcgatacgatttttgcggcg
actggcgtcactgatggctcccttatcagaggagtctataaggatttgcgcggtgtttca
gttacccaaagtcttattatgcaggccagcactggccaagtcagttatatcacgacagaa
catagacatattcctgacctagcgacttttatgaaataa

DBGET integrated database retrieval system