KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0510
Entry
ZMO0510           CDS       T00221                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00020  Citrate cycle (TCA cycle)
zmo00620  Pyruvate metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
Module
zmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0510
   00020 Citrate cycle (TCA cycle)
    ZMO0510
   00620 Pyruvate metabolism
    ZMO0510
Enzymes [BR:zmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ZMO0510
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N ATP-synt_ab_Xtn
Other DBs
NCBI-ProteinID: AAV89134
UniProt: O66119
Position
509031..510353
AA seq 440 aa
MSIEVKMPALSPTMTEGTLAKWLVKEGDAVKAGDILAEIETDKAIMEFETVDAGIIAKIL
VPEGSENIAVGQVIAVMAEAGEDVSQVAASASSQISEPSEKADVAQKETADSETISIDAS
LDKAISNAGYGNKTENMTASYQEKAGRIKASPLAKRLAKKNHVDLKQVNGSGPHGRIIKA
DIEAFIAEANQASSNPSVSTPEASGKITHDTPHNSIKLSNMRRVIARRLTESKQNIPHIY
LTVDVQMDALLKLRSELNESLAVQNIKISVNDMLIKAQALALKATPNVNVAFDGDQMLQF
SQADISVAVSVEGGLITPILKQADTKSLSALSVEMKELIARAREGRLQPQEYQGGTSSIS
NMGMFGIKQFNAVINPPQASILAIGSGERRPWVIDDAITIATVATITGSFDHRVIDGADA
AAFMSAFKHLVEKPLGILAQ
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgtcgattgaagtcaaaatgccagcgctttcgcctacaatgacagaaggcacccttgcg
aaatggctggtgaaagaaggggatgccgttaaggcgggcgatattctggccgaaatcgaa
accgataaagcgattatggaatttgaaacggttgatgcagggatcatcgctaaaattcta
gtgccggaaggtagtgaaaatattgctgtaggtcaggtgattgctgtcatggccgaagcg
ggcgaagatgtttctcaagtcgccgcttctgcttcatcccagatatcagaaccttctgaa
aaagcagatgtcgcacagaaagagacggcagatagtgaaacgatatccatcgatgcctct
ctcgataaggcaatcagcaacgcaggttatggcaacaaaacagagaatatgacggcttcc
tatcaagaaaaagcagggcggataaaagccagtcctttggccaagcgcttggctaagaaa
aaccatgttgacctgaaacaggtaaacggtagtggcccccatgggcggattatcaaagct
gatattgaagccttcattgctgaggctaatcaagcctcttctaatccgtcagtctctacg
ccggaagcctccggtaaaataacgcatgatacgccccataatagcatcaagcttagcaat
atgcggcgcgttattgctcgtcgtctgactgaatccaaacaaaatattcctcacatctac
ttgacggttgatgtccagatggatgctcttttgaagctccgctctgagctcaatgaatcc
ttagctgttcagaatattaaaatctcagtcaatgacatgctgattaaggctcaggcttta
gccttaaaagcaacgcctaacgtcaatgttgcttttgatggcgatcagatgctgcaattc
tcacaggccgatatctctgtcgctgtctctgttgaaggtgggctgattacgcctatcttg
aaacaagctgataccaaaagcttgtctgcgctttctgtcgaaatgaaagagcttattgct
cgcgcaagggaagggcgcttgcaacctcaggaatatcagggcggaacgtccagtatttct
aatatggggatgtttggtatcaagcagtttaatgctgtcatcaacccgccacaggcctct
attttagcgattggaagcggtgaaagacggccttgggtgattgatgatgcgatcaccatt
gctaccgttgcaactatcaccggtagttttgatcatcgtgttattgatggtgccgatgcg
gctgcctttatgtcagccttcaagcatttggttgaaaaaccattagggattttagcacaa
tga

DBGET integrated database retrieval system