KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0512
Entry
ZMO0512           CDS       T00221                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00020  Citrate cycle (TCA cycle)
zmo00260  Glycine, serine and threonine metabolism
zmo00280  Valine, leucine and isoleucine degradation
zmo00310  Lysine degradation
zmo00380  Tryptophan metabolism
zmo00620  Pyruvate metabolism
zmo00630  Glyoxylate and dicarboxylate metabolism
zmo00640  Propanoate metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
zmo01240  Biosynthesis of cofactors
Module
zmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0512
   00020 Citrate cycle (TCA cycle)
    ZMO0512
   00620 Pyruvate metabolism
    ZMO0512
   00630 Glyoxylate and dicarboxylate metabolism
    ZMO0512
   00640 Propanoate metabolism
    ZMO0512
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZMO0512
   00280 Valine, leucine and isoleucine degradation
    ZMO0512
   00310 Lysine degradation
    ZMO0512
   00380 Tryptophan metabolism
    ZMO0512
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zmo04147]
    ZMO0512
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     ZMO0512
Exosome [BR:zmo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ZMO0512
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 3HCDH_N K_oxygenase 2-Hacid_dh_C AlaDh_PNT_C Thi4
Other DBs
NCBI-ProteinID: AAV89136
UniProt: P50970
Position
510845..512245
AA seq 466 aa
MADHFDLIVLGGGPGGYVAAIRAAQLNLKVALVERVHLGGICLNWGCIPTKSLLRSAEVY
HEMQNAEAYGLTSFKPDFDLDKIIARSREVATRLASGVKTLLRKNKVEVISGVGQLTGNQ
QMLVETTEGEEKILEAKDIIIATGARARQLPNVHSDGKHIWTYHHALKPPAMPKKLLVIG
SGAIGIEFASFYADFGAEVSIVEHAPQILPMEDAEVSAYVAKAFKKRGIRILTQSALQNL
TPDDEGVTAEIAGADGKVTKERFSHAIVAIGVVANVENIGLDKLGIKLDRGFIAVDGFGR
TNVDHVWAIGDVAGAPCLAHKASHQGVIAAEAIAGCDHVHPLNTQNIPGCTYARPQVASV
GLTEEKARQQGYNVKIGNFPFIANGKAIAQGATDGFVKTVFDADSGALLGAHMVGAEVTE
MIQGYTVARTLETTEAEIMETIFPHPTLSEAMHESVLAAYGRALHF
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggctgatcattttgatctgattgttttgggcgggggtccaggaggatatgtcgcggct
attcgggcggctcagctaaacctgaaagtcgctttggttgaacgcgtccatctaggtggt
atctgcttgaattggggctgtatcccgaccaaatcgcttctgcgctctgctgaagtctat
catgagatgcaaaatgccgaagcctatggtctaacctctttcaaacctgactttgatctc
gataaaattattgcacgttcgcgcgaagtagccacccgtctagcctccggcgttaaaaca
ttattgcgcaaaaataaggttgaagttattagcggcgtcggtcaactgacgggtaatcag
caaatgctggtagaaacgaccgaaggtgaagaaaaaatccttgaagccaaggatattatc
atcgcaactggagcaagagctagacagcttcccaatgttcattctgatggcaagcatata
tggacttaccatcatgctttaaaaccacctgccatgccaaaaaaattgctggtaatcggg
tcgggggctatcggtatcgaattcgccagcttctatgctgattttggggctgaagtgagc
atcgttgaacatgcgccccaaattctgccgatggaagatgccgaggtgagcgcttatgtc
gctaaagcctttaaaaagcgcggtattcgtattctgacacagtcggctttacagaatttg
acgccagatgatgaaggcgtaacggctgaaatcgccggagctgatggcaaggttacgaaa
gaacgtttttctcatgctattgtcgccatcggtgtggtggccaatgttgaaaatatcggt
cttgataaactcggaattaaacttgatcgcggttttatcgccgtcgatggctttggtcgt
accaatgtcgatcatgtctgggcaatcggagatgtcgctggagcaccttgcctcgcgcat
aaagccagccatcaaggggttattgcggccgaggccatcgcaggttgtgaccatgttcat
cctttaaatacccaaaatattccgggatgcacctatgcaaggccacaagttgccagtgtg
ggtctcactgaagaaaaagcgcggcaacagggctataatgtcaaaataggcaatttcccc
tttatcgctaacgggaaagctattgctcaaggggcaactgatggctttgttaaaaccgtt
tttgatgccgacagtggtgcgcttttaggcgcgcatatggttggggctgaagtaactgaa
atgattcagggctataccgtcgccagaacgctggaaaccaccgaagcggaaatcatggaa
acgatctttcctcatccgactctttcggaagccatgcatgaaagtgtgctagctgcctac
gggcgcgcactgcatttttaa

DBGET integrated database retrieval system