KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0513
Entry
ZMO0513           CDS       T00221                                 

Definition
(GenBank) phosphoesterase PA-phosphatase related protein
  KO
K19302  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO0513
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO0513
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     ZMO0513
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Precursor biosynthesis
  Diphosphatase
   ZMO0513
SSDB
Motif
Pfam: PAP2 PAP2_3
Other DBs
NCBI-ProteinID: AAV89137
UniProt: Q5NQ68
Position
512257..512964
AA seq 235 aa
MPFFLSGWRWVAIVFFCIIAFLIGFLTACEAPGAFDLTLLHLIGGFASRHHWVACIARIG
SFAGNVSVRVSCILVAVITMIALKDKLGAIFAILAPLGGWAFFSLLKLVINRPRPLIFFH
LDHVDGASFPSGHSTNAMIVYPMLALLIRRHGGRLGWLYASIVLAVFVGLSRVALAVHWP
SDVMAGWVAGSAWLLVCYEICEQWGLRHSDPLSVKMRDEEDEDVNAHLKHHESMS
NT seq 708 nt   +upstreamnt  +downstreamnt
ttgcctttttttctgagtggctggcgttgggttgccattgtctttttttgtatcatcgcc
tttctgatcggttttctgactgcctgtgaggcgcctggtgctttcgaccttaccctactg
catttaatcggtggctttgcctctcgccatcattgggtggcctgtatcgcccgtattggt
agctttgccggtaatgtttctgtccgtgtcagctgtattcttgtcgcggttataacaatg
atagcccttaaagataaattaggggctatttttgctatcttggcacctttggggggatgg
gcttttttttcgctcttgaaattggttattaaccgccccagacccttgatcttttttcat
ctggatcatgttgatggcgctagtttcccaagcggtcacagcaccaatgccatgatcgtc
tatccgatgcttgctttgttaattagacgtcatggtggccgcctcggttggctttatgcg
tctattgtcttggcggtttttgtcggtttgtcccgtgtcgcgctggctgttcattggcct
agcgatgttatggctggatgggtggctggcagcgcatggcttcttgtctgctatgaaatc
tgtgaacaatgggggctgcgccattcagatccgttatctgtcaaaatgagagatgaagag
gacgaggatgtaaatgcccatttaaaacatcatgaatccatgtcttga

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1115
Entry
ZMO1115           CDS       T00221                                 

Definition
(GenBank) undecaprenol kinase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO1115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO1115
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     ZMO1115
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Precursor biosynthesis
  Diphosphatase
   ZMO1115
SSDB
Motif
Pfam: BacA TauE TgpA_N
Other DBs
NCBI-ProteinID: AAV89739
UniProt: Q9RNL1
Position
1129573..1130376
AA seq 267 aa
MHDSLLTIILLGILEGVTEFIPVSSTGHLILAERLLGAHGANSASFDIIIQLGAILAVIV
FYWERFLNIAKGLFQHSTSSWHFVRNILCGFIPTVIVGAIAYHAVKALLEKPMVVAIALF
VGGIAMLIIDRESSHPENTSVQSIPAHKAVLVGLAQCLAMIPGVSRSGATIMGALCLGID
RKTATEYSFFLAIPVMLAATVKELWEQRHNLHIADFGEISLGFVISFVTALIVIKLFLEI
VTRRGFAPFAWYRIIIGLVAFAFLLFN
NT seq 804 nt   +upstreamnt  +downstreamnt
atgcatgactctttgttgacgattattttgcttggtattctggaaggtgtcacggaattt
attccggtctcctcgaccggtcaccttatcctcgctgaaaggctgttaggcgcccatggt
gccaattccgccagctttgatattattatccaactcggcgctatcttagccgtcatcgtt
ttttattgggaacgattcctgaatattgccaaagggttgtttcagcattccacatcttca
tggcattttgtcagaaatattctttgcggttttattccgaccgttattgtcggggctatc
gcctatcatgccgtcaaagccctattggaaaaaccaatggtggttgcaattgccttattt
gtcggtggtatcgcgatgttaatcattgatcgcgaatcatctcatcccgagaatacctcg
gtgcaatctattccggctcacaaagccgttctggttggcttagcgcaatgtctggcgatg
atccccggggtcagccgttccggtgccacgattatgggcgcgttatgtctgggtatcgat
cgtaaaacagccactgaatatagcttctttctagctattccggtcatgctggccgctacc
gtcaaagaattatgggaacagcgtcacaatcttcatatcgcggattttggtgaaatcagc
cttggctttgtaatttcttttgtgacggccttgattgttatcaaattatttttggaaatc
gtcacccgccgcggttttgcgccctttgcttggtatcggattattatcggtctggtagct
tttgcttttctcttgtttaattag

DBGET integrated database retrieval system