KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0564
Entry
ZMO0564           CDS       T00221                                 

Definition
(GenBank) Polyprenyl synthetase
  KO
K02523  octaprenyl-diphosphate synthase [EC:2.5.1.90]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00900  Terpenoid backbone biosynthesis
zmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ZMO0564
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:zmo01006]
    ZMO0564
Enzymes [BR:zmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.90  all-trans-octaprenyl-diphosphate synthase
     ZMO0564
Prenyltransferases [BR:zmo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ZMO0564
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-ProteinID: AAV89188
UniProt: Q5NQ17
Position
562438..563451
AA seq 337 aa
MTAINSATDRNQAASLKPLMHLVASDMQAVNQVILDRMQSEVPLIPELAGHLISSGGKRM
RPMLMLACSRLIGEPRDIHYKLAAAIEFIHTATLLHDDVVDHSDLRRGKRTANNIWGNGP
TVLVGDFLLSRAFEMMVESGSLRALEILSNAAAIITQGEVDQLVSQYQVETDEARYLSII
GAKTAVLFAASCRIAAVMAGCSKDKEQSLADYGQYLGIAFQLTDDAIDYMSDSQTMGKGV
GDDFRDGKVTLPVILAYQRGEKADRDFWREAIEGRRVADSDLDIAKILLVNTDALSDTLE
RARLYGEKAIQSLKAFPDGAVKEALVEAVEFTIARAY
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaccgccatcaattctgccacagatcgaaatcaggcggcctctttgaagccgttaatg
cacctggtcgcctctgatatgcaggctgtaaaccaagtcattcttgatcggatgcaaagc
gaagttccccttatccctgaattggcaggccaccttatttccagcggcgggaaaagaatg
cggcctatgctgatgctggcctgttcccgtttgataggtgaaccacgtgatattcattat
aaattagcggccgctatcgaatttattcacacggcaactttgttgcatgacgatgttgtg
gatcatagcgatttacggcgaggtaagcggacggccaataatatttggggcaatgggccc
actgttttggttggcgactttctcctaagccgcgcttttgaaatgatggttgaatccggc
tccctacgggcgcttgaaattctgtctaatgcggcggcaattattacccaaggtgaggtg
gatcagcttgtttcccaatatcaggtggaaacagacgaagcgcgttatctgtctattatt
ggtgcaaaaacggctgtcttatttgcggcatcctgtcggatcgcagcggtcatggcgggc
tgttcgaaagataaagaacaaagtcttgccgattatggtcagtatttaggtatcgccttc
cagctaaccgatgatgctattgattatatgtcggatagccagaccatgggtaagggtgtc
ggcgatgatttccgcgacgggaaagtgacccttccggtcattctagcctatcagcggggt
gaaaaggctgaccgcgatttctggcgtgaagctatagaaggccgccgcgtcgctgacagt
gatcttgatattgccaaaattctattggtaaatacggatgccttgtcggacaccttggaa
cgcgctcgtctttatggtgaaaaagctatccagtctttgaaggcttttcctgacggtgca
gtgaaagaggcgttggtagaagccgtcgaatttacaatcgcccgcgcttattaa

DBGET integrated database retrieval system