KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0677
Entry
ZMO0677           CDS       T00221                                 

Definition
(GenBank) 3-isopropylmalate dehydrogenase
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00290  Valine, leucine and isoleucine biosynthesis
zmo00660  C5-Branched dibasic acid metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01210  2-Oxocarboxylic acid metabolism
zmo01230  Biosynthesis of amino acids
Module
zmo_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    ZMO0677
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ZMO0677
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     ZMO0677
SSDB
Motif
Pfam: Iso_dh DUF166 DUF6259
Other DBs
NCBI-ProteinID: AAV89301
UniProt: Q5NPQ9
Position
complement(669245..670294)
AA seq 349 aa
MRIALLAGDGIGPEITAEAVKILKAVVGQEIEFDEALIGGAAWKVTGSPLPEETLKLCKN
SDAILFGSVGDPECDHLERALRPEQAILGLRKELDLFANLRPARLFPELQAESPLKENIV
TGTDLMIVRELTGDVYFGTPRGQRKDDQNRREGFDTMRYNEDEVKRIARIGFETARSRSG
NLCSIDKSNVLETSQLWRTVVLEIAQEYPDVELSHMYVDNAAMQLVRAPDQFDVIVTGNL
FGDILSDLASACVGSIGLLPSASLNSEGKGLYEPIHGSAPDIAGLGKANPLATILSGAMM
LRYSLKREADADRIEKAVSTALEKGARTADLGGKMTTSEMGNAVLAALN
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcgcattgcattgttggccggagatggaatcggccctgaaattacagctgaagccgtc
aaaatcttaaaggcggttgtcggtcaggaaatcgaatttgacgaagctttgatcggcggc
gctgcatggaaagtaacgggaagcccgttaccggaagaaaccctgaaattatgcaaaaat
agtgatgcaatcctgtttggttcagtcggtgacccagaatgcgatcatcttgaacgcgct
ttacgtccagaacaggctattttaggtcttagaaaagaactggatttattcgccaatttg
agacctgcgcgtttattccctgaattacaggcagaatcacctttaaaagaaaatattgtc
accggcaccgatcttatgatcgttcgtgaattgacgggtgatgtctatttcggcacgccc
cgtggccaacgcaaagatgatcagaatcgccgtgaaggttttgatacgatgcgctataac
gaagatgaagtaaaacgcatcgctcgcattggttttgaaacagcacgctcccgcagcggg
aacctctgttcgattgacaagtccaatgttctcgaaacctcgcagttatggcggactgtt
gtgctggaaatcgctcaggaatatcctgatgttgaactcagccatatgtatgttgataat
gcagcgatgcagcttgttcgcgcaccagatcagtttgatgttattgttaccggtaatctc
tttggcgacattctttctgacctggcctcagcttgcgtcggctcaatcggcttattgccc
tccgcttcacttaatagcgaaggtaaaggcctctacgaaccgattcacggctctgctcct
gatattgccggactgggtaaagccaatccactggcaacgattctgtccggtgctatgatg
ctgcgctacagcctgaagcgtgaagcagacgctgatcgcatcgaaaaagctgtttcgaca
gctcttgaaaaaggcgctcgtacggctgaccttggtggtaaaatgactacctctgaaatg
ggaaatgctgttttagcggctcttaactga

DBGET integrated database retrieval system