KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0687
Entry
ZMO0687           CDS       T00221                                 

Definition
(GenBank) thiamine pyrophosphate protein TPP binding domain protein
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00290  Valine, leucine and isoleucine biosynthesis
zmo00650  Butanoate metabolism
zmo00660  C5-Branched dibasic acid metabolism
zmo00770  Pantothenate and CoA biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01210  2-Oxocarboxylic acid metabolism
zmo01230  Biosynthesis of amino acids
Module
zmo_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
zmo_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ZMO0687
   00660 C5-Branched dibasic acid metabolism
    ZMO0687
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ZMO0687
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ZMO0687
Enzymes [BR:zmo01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     ZMO0687
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-ProteinID: AAV89311
UniProt: Q5NPP9
Position
complement(680860..682521)
AA seq 553 aa
MSDTKSTVAKLLVKCLEAEGVEYVFGIPGEENIRLIDAMADSSIRFILVRHEQGASFMAD
MYGRLTGKAGVCTATLGPGAINLLLGVADAQTDSTPMVAISAQVGLNRIYKESHQYIDLQ
GMFAPVTKWSDTILTPASVPEMMRKAFDLAQRERPGAVYLAVPQDLEESDVSADLKPITV
HPVHTTAPDPDQVAATIDLIKKAKQPIILAGHGVARSHASKQLIELSELLNVPVATTFMA
KGVIPDRHPNALGVAGFMRRDYENFAFDAADVILSVGYELQEFAPSKINPNHDKKIVHIH
HFAEDIDAAYPVAIAIEADIDKSLDALIDGLKKTTFPKFDNHAKIKQIKKEELDGNADDQ
SFPLKPQRIISDIRKAMGDDDIVLADTGAIKMWMARLYPTQKPSTCLISNGLSTMAFALP
GALAAKLACPDRKVLAVMGDGSFLMNSQEIETAIRENIPLVVLIWVDDAYGLIKWKMDLE
IKHHRDVDFTNPDFVQYAESFGAKGYEIKSADMLLPVIEKALADDGVSIIACPVDYAENN
KLTDKLGDLTITI
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgtctgatacaaagtctacggtggcgaagctgttagttaaatgccttgaagccgaaggc
gtcgaatatgtttttggtatcccgggtgaagaaaatatccgtcttattgatgccatggcg
gattcttctatccgtttcatcctggttcgccatgaacaaggtgcatcctttatggcggat
atgtatggtcgcctaactggcaaggccggtgtttgcaccgcaaccttggggcccggtgcc
atcaatcttttactaggcgttgccgatgctcaaaccgatagcactcctatggttgccatc
agtgcgcaagtcggccttaaccgtatttataaagagtctcatcaatatattgaccttcag
ggcatgtttgcccctgttaccaaatggtcagacacgatcctgacgccagcatccgtgcca
gaaatgatgcggaaagcctttgaccttgcccaaagagaacgccctggtgcggtttatcta
gcagtaccacaggatttagaagaatctgatgtctctgcggatttaaagccaatcaccgtc
catccggttcacacaacagcaccagatcctgatcaggtagctgccacgattgatttgatt
aagaaggcaaagcagccaatcattctggcgggtcacggcgttgcgcgcagccatgcctca
aaacagctcattgaattgtctgaacttttaaacgttccggttgcaactacttttatggca
aaaggtgtcattcctgatcgccaccccaatgctctgggtgttgctggctttatgcgccgc
gactatgaaaattttgcgtttgatgcagctgatgtcattttgtcagttggatatgaattg
caggaatttgcaccttcaaaaatcaatcctaatcacgacaaaaagattgtccatatccat
cactttgctgaagatatcgatgcagcttatccggtagccattgctattgaagcggatatc
gacaaatctttggatgcgttgattgatggattgaagaaaacaactttcccgaaattcgac
aatcatgccaaaattaaacagatcaaaaaagaagaattagacgggaatgcggatgatcag
agcttcccgctgaaaccacagcggattatctctgatatcagaaaagctatgggcgatgat
gatatcgttctggctgatacaggcgctatcaaaatgtggatggctcgcctctatccgacc
cagaagccttcgacttgtttaatttcaaatggtctctctacgatggcctttgcgctacca
ggtgctttggctgctaaacttgcctgccctgaccggaaagttctcgctgtaatgggcgac
ggctcattcctgatgaattcacaggaaattgaaacagctatccgcgaaaatattccgctg
gttgtgctgatctgggtcgatgacgcttatggtcttattaaatggaaaatggatctggaa
ataaagcatcaccgggatgtggactttaccaatcctgattttgttcaatatgcagaaagt
ttcggggctaaaggctacgaaatcaaaagtgccgatatgttgttacctgtcattgaaaaa
gcattagccgatgatggtgtgtctatcatcgcttgcccagtagactacgcagaaaacaac
aaattgaccgataaattaggtgatctgacgatcacaatctaa

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1139
Entry
ZMO1139           CDS       T00221                                 

Definition
(GenBank) acetolactate synthase, large subunit, biosynthetic type
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00290  Valine, leucine and isoleucine biosynthesis
zmo00650  Butanoate metabolism
zmo00660  C5-Branched dibasic acid metabolism
zmo00770  Pantothenate and CoA biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01210  2-Oxocarboxylic acid metabolism
zmo01230  Biosynthesis of amino acids
Module
zmo_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
zmo_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ZMO1139
   00660 C5-Branched dibasic acid metabolism
    ZMO1139
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ZMO1139
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ZMO1139
Enzymes [BR:zmo01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     ZMO1139
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M POR_N
Other DBs
NCBI-ProteinID: AAV89763
UniProt: Q5NNE7
Position
1155710..1157497
AA seq 595 aa
MCRQLSGAAIVLETLKDMGVDLIFGYPGGAVLPIYDALYQDEGIRHILARQEGGAVHAAE
GYARSTGKPGVVIVTSGPGATNAVTGIADAMLDSIPLVVFSGQVATNLIGTDAFQEADTI
GITRHCTKHNYLVRDPKDLAQTIVEAFHLATSGRPGPVVIDLPKNVQTAVIDYIKPDPNK
RMHRGYRPRVKADPVEITNALDMIAKAKRPVFYTGGGVINSGPDASKALRELADLTGVPV
TSTLMGLGAFPASSQQWLGMLGMHGTYEANFAMHDADLVVALGSRFDDRVTCRVDSFSPH
SKKIHVDIDRSSINRIIHVDLPIVGDVGSVMQDMVALWKEKHYQMQDISAWWVQIDEWRA
KQCLNFTKQGNEIMPQQAIRSLWEATKGKNPIVSTEVGQHQMWTAQYFGFDSPNHFLTSG
GLGTMGYGFPSIIGAQVGNPDSLCMTIAGEASFQMNIQEMATVAQYRLPVKIFILNNRFM
GMVRQWQDLLYDHRRSQSYSEALPDFVALAKAYGWNALKIEKPSQLEDGIKTMLETPGPV
LVDCQVAQLANCLPMVPPGAGQTEMILESDITDNHVKKPEYTPSAAPSSATTIRG
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgtgtcgccaactcagcggcgccgccattgttcttgaaacactcaaggatatgggtgtc
gatctgatcttcggctatcccggcggagcagttctccccatttacgatgccctttatcag
gatgaaggcatccggcatattctggctcgccaagaaggcggggctgtccatgcagcagaa
ggctatgcgcggtcgaccggaaaacccggtgttgttatagtgacttcaggtccgggggcg
acaaatgccgttaccggcatcgctgatgccatgcttgattccattccgttggttgttttt
tctggtcaggtcgccacgaatttaatcggaaccgatgctttccaagaggcggataccatc
ggcattacccgccattgcaccaagcataactatctggttcgcgacccgaaggatttagct
cagacgattgtcgaggccttccatctggcgacctccggtcgtccgggaccggtggttatt
gaccttccgaaaaatgttcagacggcggttatcgactatatcaaaccggatcctaacaag
cggatgcatcgcggttatcgtccgcgtgttaaagcggatccagtcgaaattaccaacgct
cttgatatgattgccaaggcaaagcgtccggttttctatactggtggcggcgttatcaat
tctggtcccgatgccagcaaagccttgcgtgaattggccgacttgacgggtgttccggta
acctcaaccctgatgggcttgggcgcatttccagcctcttcccagcaatggttgggtatg
cttggtatgcacggcacttacgaagccaattttgccatgcatgacgctgatttagtagtt
gcccttggcagccgctttgatgatcgtgtgacatgtcgggttgatagcttttcacctcat
tccaagaaaatccatgtcgatattgatcgttcttcgatcaaccgtatcatccatgtggac
ttaccgattgtgggtgatgtcggatcagtcatgcaggacatggtcgcgctttggaaagaa
aagcattaccagatgcaggatatttcggcatggtgggtgcagattgatgaatggcgcgcc
aaacaatgcctgaattttaccaagcagggtaacgagatcatgccgcagcaggctatccgt
agcctgtgggaagccacaaagggtaagaatccgatcgtctcgacagaagtcggacagcat
cagatgtggaccgcccaatatttcggttttgactctcccaatcatttcctgacttcaggt
ggtttgggaacgatgggctatggtttcccgtctattattggcgcgcaggtcggtaatcca
gacagcctctgcatgacgattgctggtgaagcctctttccagatgaatattcaggaaatg
gctacggttgctcaatatcgtttgccggtgaaaattttcatcttgaataaccgtttcatg
ggcatggtgcgtcagtggcaagatttgctttatgatcatcgccggtcacaaagctattca
gaagcactgcctgattttgtcgctttggccaaggcttatggctggaatgcgcttaaaatt
gagaagccttcccagcttgaagatggcatcaaaacgatgttggaaacgccggggcctgtc
ttggttgattgtcaggttgctcaattagcgaattgtttgcccatggtgccgccgggagcc
ggccagactgaaatgattttggaatcggatatcaccgataaccatgtcaagaagccggaa
tataccccttccgctgcgccttcgtctgcgaccaccattcgcggttaa

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1140
Entry
ZMO1140           CDS       T00221                                 

Definition
(GenBank) acetolactate synthase, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00290  Valine, leucine and isoleucine biosynthesis
zmo00650  Butanoate metabolism
zmo00660  C5-Branched dibasic acid metabolism
zmo00770  Pantothenate and CoA biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01210  2-Oxocarboxylic acid metabolism
zmo01230  Biosynthesis of amino acids
Module
zmo_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
zmo_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ZMO1140
   00660 C5-Branched dibasic acid metabolism
    ZMO1140
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ZMO1140
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ZMO1140
Enzymes [BR:zmo01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     ZMO1140
SSDB
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4
Other DBs
NCBI-ProteinID: AAV89764
UniProt: Q5NNE6
Position
1157519..1158031
AA seq 170 aa
MDSGEVIERHTLSVTVDNVAGILARISGMFSTRGYNIESLTVADVTKDNAISRLSIVTSG
LPHVIDQMVHQLDRLPPVHRVVDLTAIGPHVERELALIKVVGVGDNRIEALRLAEVYHAR
VVDATIASFIFEVTGTTEKVEKFLELMGELGLVEVARTGIAAMARGRDAF
NT seq 513 nt   +upstreamnt  +downstreamnt
atggatagtggagaagtgatagagcgccatacgctttctgtcactgttgataacgttgct
ggtattcttgcccgcatttcaggcatgttttctaccagaggctataatatcgaaagcctg
acagttgcggatgtcacaaaagataacgccataagccggctaagcattgtgaccagtggc
cttcctcatgtcatcgaccagatggttcaccagttggaccgtctgccgccggtgcatcgg
gttgtcgatttgacagccattggcccccatgttgaacgggaattagcccttattaaagtg
gttggcgtaggtgataatcgtattgaagccttgcgtttggctgaagtttatcatgcccgg
gtggttgatgcgaccattgccagttttatctttgaagttaccggcacaactgaaaaagtt
gaaaaatttctcgagcttatgggtgaattgggcttggttgaagtcgcgcgcacgggtatt
gcagccatggcgcgcggtcgggatgctttttaa

DBGET integrated database retrieval system