KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0827
Entry
ZMO0827           CDS       T00221                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate/D-alanyl-D-alanyl ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00300  Lysine biosynthesis
zmo00550  Peptidoglycan biosynthesis
zmo01100  Metabolic pathways
zmo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    ZMO0827
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO0827
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ZMO0827
Enzymes [BR:zmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     ZMO0827
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase MurT_C
Other DBs
NCBI-ProteinID: AAV89451
UniProt: H2VFN8
Position
829577..830968
AA seq 463 aa
MKALWQSEAIARAVKGTASADFSVRNVAFDSREIQKGDLFFALKGTESDGHNYVEAAFKR
GAAGAVVMSPVPYPHILVDDSYQALKDLAVASRKRNHGKIIGITGSVGKTSTKESLRLAL
ERMAPEKVHYSLKSYNNHVGVPLSLARMPEESLFGIFEMGMNHAGELSDLTKLVQPDVAL
ITAIAPAHAAFFADETAIAEAKSEIFEGLSSGGIAIIPHDSPYRDLLTAKAQEKKAEIRS
FGFGEGATIRAQNIVREADGRVLVTASIRDRQLVFSMAMAAEHWISNAMAVLAVVDAVGG
DLTLASLALGDITGFQGRGQRFDIPVGDGSAIVIDESYNANPASMAATIKALENEPKDKR
RIVLLGDMLELGQNSAAYHRALADPLSHAKVDHVLLVGQEMAALEESLAGKIACDRIEKA
DQAEALLDEILKADDILLVKGSNSLGLSAVVSSLSKKGCACSI
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgaaggctttatggcaatctgaagctattgcacgcgctgtaaagggtacggcttcggct
gatttttctgttcggaatgtcgcctttgactcccgcgaaattcaaaagggcgatttattc
tttgctttaaaaggcacggaatccgatgggcataactatgtcgaggcggccttcaaaagg
ggcgccgctggagcggtggttatgtcgccggtgccttatcctcatattcttgttgatgac
agttatcaggctttgaaggatttggcggttgcatccagaaaacgcaaccatggtaaaatt
atcggcatcaccggatcagtcgggaaaaccagcaccaaagaatccttgcgtcttgccttg
gaaagaatggcaccggagaaagtccattattcgctaaaaagctataataatcatgtcggt
gttcctttgagcctcgcccgtatgccggaagaaagtcttttcggtatttttgaaatgggt
atgaatcatgcgggggaattatctgatctgaccaagcttgttcagcctgatgttgccttg
ataacggcgatcgcaccggcacatgctgctttttttgcagatgagaccgctattgccgaa
gcgaaaagcgaaatatttgaaggtctatcatcgggcgggatcgctattatccctcatgat
tccccttatcgcgatttattgacagctaaagcccaagagaaaaaggctgaaattcgtagt
tttggttttggcgaaggggcaaccattcgcgcccagaatatcgttcgtgaggcagatggg
cgtgtgcttgtaaccgcctctattcgtgatcgccaacttgtcttttctatggcgatggct
gccgagcattggatttcaaatgcgatggctgttttggcggtggtggatgcggttggcggt
gatttaaccttagctagtttggccttgggtgatattaccggtttccaaggtaggggacag
cgttttgatatccctgttggagatggaagcgctattgttattgacgaaagctataacgcc
aatccagcatcaatggcggcaacgatcaaggctttagaaaatgagccaaaagacaaaaga
cgtatcgttttattaggcgatatgctggaattaggtcaaaattctgccgcttatcatcgg
gcattggcagaccccttatcccatgcaaaagtagatcacgttttattggtcggtcaggaa
atggctgctttggaagaaagccttgccggtaaaatcgcgtgtgatcgaatagaaaaggcc
gatcaggcagaagcgcttttggatgagatattgaaagccgatgatattttgttggttaaa
gggtcgaatagtctgggattatccgcggtggtttcgtctctttcgaaaaagggctgtgca
tgttctatctga

DBGET integrated database retrieval system