KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0828
Entry
ZMO0828           CDS       T00221                                 

Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00550  Peptidoglycan biosynthesis
zmo01100  Metabolic pathways
zmo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO0828
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ZMO0828
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO0828
Enzymes [BR:zmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     ZMO0828
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Precursor biosynthesis
  Glycosyltransferase
   ZMO0828
SSDB
Motif
Pfam: Glycos_transf_4 MraY_sig1
Other DBs
NCBI-ProteinID: AAV89452
UniProt: P56834
Position
830956..832026
AA seq 356 aa
MFYLIASAEGFSRLFNLIRYITFRTGAAAITALLIGLIFGPRFIGWMRIHQHKGQPIRDD
GPKTHLAKAGTPTMGGLMILIAVSISLFLWMDFANPYVWACIAVMLGFGVIGFIDDYDKV
TQNSTRGVSGKVRLLWEFGIAFFACYLILKDGNTQLYLPFYNGPVIDLGWFYYPFAAFVI
VGTANSVNLTDGLDGLATMPVIIASLAFFVISYVVGNAVFAHYLGIPHVPGAGELTILTG
AIIGAGFAFLWFNAPPAAIFMGDTGSLALGGCLGTIAVATHHEIVLGIVGGLFVAEALSV
IIQVGFYKRFKRRVFRMAPLHHHFEQLGWSEPTVVIRFWIISFALALLGLATLKLR
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgttctatctgattgcctcggcggaaggcttttcccgattatttaatctgatccgttat
attactttcagaacaggggcggcggctatcaccgccttgttaatcggtttgatttttggc
ccgcgttttattggctggatgcgtattcaccagcataaagggcaacctatccgtgatgat
ggcccgaaaacgcatctagcaaaggctggcaccccgacgatgggggggctgatgattctg
atcgcggtctctatctcgctctttctatggatggattttgccaatccctatgtttgggct
tgtatcgcggtgatgttgggctttggtgtgatcggatttatcgacgattatgacaaagtg
acccaaaattcaacgcgcggtgtttccggtaaagtccggctgttatgggaatttgggatt
gccttttttgcctgttatctgattttgaaagacggcaatacccaactctatttgcctttt
tataatggccctgtgattgaccttggttggttttattatccctttgcagcttttgtgatt
gttggcactgccaattctgtcaatctgaccgatggtcttgatggtctggcaacgatgccg
gtgattattgccagtcttgcctttttcgttatcagttatgtcgttggtaatgccgttttt
gcgcattatctcggtattcctcatgtccccggtgccggagagttaacgattttgacaggg
gctattatcggggcgggttttgcttttctgtggtttaatgcaccgcctgcggccatcttt
atgggtgatacggggagccttgctttggggggatgccttggcacgattgcggttgcgacc
catcatgaaatcgttttgggcattgttggtggccttttcgtcgcagaagccttgtcggtg
attattcaggtcggtttttacaagcgttttaagcggcgcgtattccgtatggcaccgctt
caccatcattttgaacaactgggttggtcagagccgaccgtggtgatccgtttctggatt
atcagttttgctctggctttgcttggtctagcaacgttgaagttaagatga

DBGET integrated database retrieval system