KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0831
Entry
ZMO0831           CDS       T00221                                 

Definition
(GenBank) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00550  Peptidoglycan biosynthesis
zmo01100  Metabolic pathways
zmo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO0831
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ZMO0831
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO0831
Enzymes [BR:zmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     ZMO0831
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Precursor biosynthesis
  Glycosyltransferase
   ZMO0831
SSDB
Motif
Pfam: Glyco_tran_28_C Glyco_transf_28 Glyco_trans_4_4 Glyco_transf_4
Other DBs
NCBI-ProteinID: AAV89455
UniProt: Q9RNM6
Position
834580..835743
AA seq 387 aa
MNGSRQYILAAGGTGGHMIPAHALAVELMRRGHHVALVTDERGTRFPELFKDVQIHQLPA
GRLTGGVKGLFQAMRNIWAGRERALTLYENFTPAAVVGFGGYPALPALLAAFKAKIPTVI
HEQNAVMGRTNRFLAGRVDAIATAYHQVDRLKKRYRRKTEVTGNPVRDEVLFLRDLPYPP
LSDNSIFRILVVGGSQGASILSEVVPEGLGLLPLHLRRRLQVTQQCRPEDLEKTRAQYAK
LGIPADISTYMADLPQRLGWSHLVISRAGASTIAELGVAGRPAILIPYPAAMDNHQYANA
RELVSAGGARLIDQRRFNPFELAKQIQKMALEPSALKNAAARARQVGYPDAVEKLADLVE
RVGGNLPQQNSIEEDSTFEKNQEGAVA
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaatggcagccgacaatatattctcgccgctggtggcaccggtggccatatgattcca
gcccacgcattggctgttgagttaatgcggcggggtcatcatgtggctttggtgaccgat
gaaagaggaacgcgtttccccgaattatttaaagatgtccagatacatcagcttcctgcc
ggtcgtttgacgggcggggtaaaagggttgtttcaggcgatgcggaatatctgggcaggg
cgggaacgcgccttaacgctttatgaaaattttacaccggcggcggttgtcggttttggt
ggctatccggcgttacccgcactactggcggcttttaaagcgaaaatcccgacggttatt
cacgagcaaaatgcggtgatgggacggacgaaccgttttctggctggaagagtggatgcc
attgctaccgcttatcatcaggttgatcggctgaaaaaacggtatcgtcgtaagactgaa
gtaacaggtaatccggtgcgggatgaggtcttgtttctgcgtgacctgccttatccgccg
ttaagtgacaacagcatttttcggatattggtggtcggtggtagccaaggtgccagcatt
ttgtcagaagtcgtaccggaaggtttggggttattgccgcttcatctgcggcggcggctt
caagtgacgcagcaatgccgaccggaagatttggaaaagacccgcgctcaatatgctaag
cttggtatccctgctgatatttcgacctatatggccgatttaccgcagcgtcttggttgg
tctcatttggttatttcccgtgcaggcgcttcgaccattgccgaattaggcgttgccgga
cggcctgctattcttattccttatcctgcggcgatggataatcatcaatatgccaatgcc
cgtgagcttgtttctgccggtggcgcgcgtttgattgatcaacgccgttttaatcctttt
gaactggcaaaacagattcaaaaaatggctttggagccttctgctttgaaaaatgccgct
gccagagcaaggcaggttggttatcccgatgcggttgaaaaattggctgatttggttgag
cgggtcggaggcaatctgccgcaacagaattctatagaagaagattcaactttcgaaaaa
aatcaagaaggagcggttgcatga

DBGET integrated database retrieval system