KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0832
Entry
ZMO0832           CDS       T00221                                 

Definition
(GenBank) UDP-N-acetylmuramate/alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00471  D-Glutamine and D-glutamate metabolism
zmo00550  Peptidoglycan biosynthesis
zmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ZMO0832
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO0832
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO0832
Enzymes [BR:zmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     ZMO0832
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Precursor biosynthesis
  Amino acid ligase
   ZMO0832
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C F420_oxidored
Other DBs
NCBI-ProteinID: AAV89456
UniProt: Q9RNM7
Position
835740..837170
AA seq 476 aa
MKGVGTDIGRIHFVGIGGIGMSGIAEVMHNLGYQVQGSDISEGYTVDALRQMGIKVLIGH
HAENVKDAAVVVVSSAIHRGNPEVEAALENRIPVVRRAEMLAELMRLKSTVAVAGTHGKT
TTTSMVAALLDAGGIDPTVINGGIINSYGSNARLGDSDWMVVEADESDGSFLRLDGTLAI
VTNIDPEHLDHYGSFEKVQDAFVEFVSNVPFYGAAFLCIDHPVVQSILPRIRDRRLITYG
FSAQADIRAVDITPISGGNRFTAVIRGRDGDIRRIENIFLPMPGRHNIQNALSAIGVALE
FSIPDAAIRDGFARFGGVKRRFSRVGEIKIGDGSVLVIDDYGHHPVEIKAVLSAARESAQ
QRVIAVVQPHRFSRLHDLMTEFQSAFNDADMVFVAPVYAAGEQPIAGVDSQALVSGLKQH
GHRSAQAVDSPRSLAIALADIIKADDIIICLGAGDITKWAAGLAADITSIREVHHL
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgaagggtgtcggcacggatatcggccgaattcactttgtcgggatagggggtatcgga
atgtccggtatcgccgaagtgatgcataatctcggctatcaggttcagggttctgatatt
tcagaaggctatactgtcgatgctttgcgccagatgggaattaaggttctgatcgggcat
catgccgaaaatgtcaaagatgcggcggtggtggttgtttccagtgctattcatcgtggt
aatcccgaagttgaagctgcccttgaaaatcgtattccggttgtacgtcgcgcagagatg
ctggctgaattgatgcggttgaaatccaccgttgctgttgctggcacccatgggaaaacc
accacgacttcgatggttgcggccttgttggatgcgggtggtattgacccgacggttatc
aatggtggcatcattaacagttatggttccaatgcgcgtttaggtgactctgattggatg
gttgtcgaagccgatgaaagcgacggcagttttttacgcttggatggcaccttggccatt
gtgaccaatattgatcctgaacatctcgatcattacggttcctttgaaaaagtgcaggat
gcttttgtcgaatttgtatccaatgtgcctttctatggtgctgctttcctgtgcattgat
catcctgtggttcaatctatcctccctcgtattcgggatagacggctgattacctatggt
ttttcggctcaggccgatattcgggcggttgatataacgcctatctctggtggtaaccgc
tttacagcggttattcgtggccgtgatggggatatccgtcggattgaaaatatcttttta
ccaatgcccggacggcataatatccaaaatgcactgtcggctatcggggtggctttagaa
ttttccattcctgatgccgctatccgtgacggttttgctcgttttggaggggtgaaacgt
cgcttctctcgggttggcgagattaagattggtgatggctcggttctggttattgatgac
tatggtcatcatccggttgagattaaggctgtcttatcagccgccagagaaagcgcgcaa
caacgcgtcattgctgtggttcagccgcatcgtttttcgcgtttgcatgatttgatgaca
gaattccaaagcgcttttaacgatgctgatatggtgtttgtcgcaccggtttatgcggct
ggtgaacaaccaatagcaggcgtggattctcaagccttggtttcgggattgaaacagcat
ggccatcgttctgcccaagctgtggattctcctcgttctttggcgattgcgcttgctgat
attatcaaggccgatgacatcattatctgtcttggcgcgggcgatattacgaaatgggcc
gcaggtcttgcggcagatattacctcaatcagagaggttcatcacttatga

DBGET integrated database retrieval system