KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0833
Entry
ZMO0833           CDS       T00221                                 

Definition
(GenBank) UDP-N-acetylenolpyruvoylglucosamine reductase
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00520  Amino sugar and nucleotide sugar metabolism
zmo00550  Peptidoglycan biosynthesis
zmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ZMO0833
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO0833
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO0833
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     ZMO0833
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   ZMO0833
SSDB
Motif
Pfam: MurB_C FAD_binding_4
Other DBs
NCBI-ProteinID: AAV89457
UniProt: Q9RNM8
Position
837167..838099
AA seq 310 aa
MTTATSSNISSKLPSIRGEIEANAPLAPLTWFRVGGNAEWLVSPYDTEDLSDFLKKIDPS
MPVRVLGIGSNVIIRDGGVSGVIIRLPRRFSWVKREEGNRLRCGGSTLGMMISKVAAAES
LTNLEFMRGIPGSIGGMIRMNAGAYGGDISKILIQVTLVRRNGDIEIWPVEKLNFAYRYS
ELPEDAIVTEALFQGQPGDKDKIEAQMNKIIAEREASQPVRSRTGGSTFKNPEGYKAWEL
IDEAGCRGLKIGDAEVSTKHANFLLNLGDATAADIENLGEEVRARVKAKFGITLEWEIKR
IGHKLDGDKA
NT seq 933 nt   +upstreamnt  +downstreamnt
atgacgactgctacatcttccaatatctcaagtaaattgccgtctattcgcggtgaaata
gaagccaatgcgcctttggcacccctgacatggtttcgggtcggcggtaatgccgaatgg
ttggtcagcccctatgataccgaagatttgtcggattttctgaagaaaattgacccgtct
atgccagttagggtgctgggtatcggttccaatgtgattattcgcgacggcggtgtttcc
ggcgttatcatccgtttgccgcgtcgtttttcatgggtcaaaagagaagagggtaatcgc
ctgcgttgtggtggatcgaccctcggcatgatgatttcaaaggttgctgctgctgaatct
ttgaccaatctagaatttatgcgcggtattccgggatccatcggtggtatgatccgcatg
aatgcgggtgcctatggcggtgatatttccaagattctgattcaggttacgctggttcgt
cggaatggtgatattgaaatctggccagttgaaaaattgaattttgcctatcgctattct
gaattgccagaagatgcgattgtgaccgaagcgcttttccaagggcaacccggcgataaa
gacaagatcgaagctcagatgaataaaatcatcgccgagcgtgaagctagtcagccggtt
cgcagccggacggggggatcgacctttaaaaatcctgaaggctataaagcctgggagctt
attgatgaagctggttgtcgtggtttgaaaatcggtgatgccgaagtttctaccaaacat
gccaattttctgttgaatttgggtgatgctaccgcagctgatattgaaaatcttggcgaa
gaagtgcgggcgcgcgttaaagcgaaattcggtattacccttgaatgggaaataaaacgc
atcggccataaactcgatggggataaggcatga

DBGET integrated database retrieval system