KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0855
Entry
ZMO0855           CDS       T00221                                 

Definition
(GenBank) Polyprenyl synthetase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00900  Terpenoid backbone biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ZMO0855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:zmo01006]
    ZMO0855
Enzymes [BR:zmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     ZMO0855
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     ZMO0855
Prenyltransferases [BR:zmo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ZMO0855
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-ProteinID: AAV89479
UniProt: Q5NP81
Structure
PDB: 
4KKM

Position
complement(865059..865955)
AA seq 298 aa
MAVNLKTMMEQVAQDIDRLFAEQLPVPEDPRRRLVEAMRYAAIGGGKRLRPLLVVATCAL
FNVDREAALRVGMAIECIHVYSLIHDDMPCMDNDDLRRGKPTVHKAFDDASAVLSGDALQ
ALAFEILSEEKIHTDPHVRLELIQALAIASGKDGMVGGQAIDLAAETSTVPFDLPTITRL
QQLKTGALFGFCLEAGAIMGRQNKDIRDRLKAYARDIGLAFQIADDLIDAEGDEAVAGKA
VGKDAAAGKATFLSLLGLEKARSQAQALVDQAIAHLSVFGSEADYLRSIARYIVARDH
NT seq 897 nt   +upstreamnt  +downstreamnt
atggcagttaatcttaagaccatgatggaacaggtcgctcaggatattgaccggcttttt
gctgaacaattaccggttccagaagacccccgtcgccgcttggtagaggccatgcgctat
gccgcaatcggtggcggaaaaagactgcgtcctcttctggttgtcgccacctgcgccttg
ttcaatgtcgatcgcgaagccgctttacgggtcggcatggctatcgaatgtatccatgtc
tattctttgattcatgatgacatgccctgcatggataatgatgatttgcggcgtggcaaa
cccactgttcataaagcctttgatgatgcttctgcggttctttccggtgacgcgcttcag
gctttggcttttgaaattctttcagaagaaaaaatccataccgatccccatgttcggcta
gaattgattcaggctttggctatcgcctccggtaaagacggtatggtcggtggacaggcc
atcgatttggccgcagaaacctcgacggtgccttttgatcttccgaccatcacccgcttg
caacagcttaaaaccggcgccttattcggtttttgtttagaagccggtgctatcatgggt
cgtcagaataaagacatccgtgatcgtctgaaggcctatgcccgtgatatcggtcttgct
ttccagattgctgatgatctgatcgatgccgaaggtgacgaagccgttgccggaaaagca
gttggtaaagatgctgccgccggaaaagcgaccttcctgtctctgttaggtctcgaaaaa
gcccgttcacaggcacaggcattagtcgaccaggcgattgctcatctgtctgttttcgga
tcagaagccgattatttacggagtattgctcgctatatcgtagcgcgcgatcactaa

DBGET integrated database retrieval system