KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0875
Entry
ZMO0875           CDS       T00221                                 

Definition
(GenBank) hydroxymethylbutenyl pyrophosphate reductase
  KO
K03527  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [EC:1.17.7.4]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00900  Terpenoid backbone biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ZMO0875
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.4  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase
     ZMO0875
SSDB
Motif
Pfam: LYTB
Other DBs
NCBI-ProteinID: AAV89499
UniProt: Q5NP61
Position
complement(884719..885741)
AA seq 340 aa
MIKIILAQPRGFCAGVIRAIEIVDQALDRVGAPVYVRHEIVHNRHVVDTLKAKGAVFVEE
LSEVPPGEVTVFSAHGVARTVQKEAEERGLPVVDATCPLVNKVHAQGRRYLSHGRTLILI
GHAGHPEIEGTLGQIDGPVHLVGSAEQVDSLDIPSDTPVAFITQTTLSVDDTRSVIAALR
KKFTDVIGPDTSDICYATQNRQAAVRDLCKQSDLILVVGSPNSSNSNRLREIGLEEGLPS
YLIADGSEIDPVWFEGINTVGLTAGASAPEELVQSVITAIRALGPVTVEQLDGVEEKIAF
RLPPTLRHLKARNAAHNNLDNKTAASEEADSLSNDTEQEA
NT seq 1023 nt   +upstreamnt  +downstreamnt
gtgataaaaatcattctggctcaaccgcgtggcttctgtgccggcgtgatccgtgctatc
gaaattgtcgatcaggcattagaccgtgtcggagcgcctgtatatgtccgccatgaaatc
gttcataatcgtcatgttgtcgatacattaaaggcaaaaggcgctgtctttgtcgaagaa
ctctccgaagttccccccggcgaagtcactgttttcagtgcgcatggcgttgctcgcacc
gttcaaaaggaagccgaagaacgcggcttgccggtggtcgatgcgacctgccctttggta
aacaaagtgcatgcgcaaggccgacgttacctttctcatggacggactttgattttaatt
ggccatgccggtcaccctgaaattgaaggtactttaggccagattgatgggcctgttcac
ctcgtcggttccgccgaacaggtagacagccttgacattccgtccgatacgccggtcgct
ttcatcacccagacaacgctttctgttgatgatacccgctcggttatcgctgcattgcgc
aaaaaatttacagatgtcattggtcccgatacctcggatatctgttacgcgacccaaaat
cggcaagctgcggtcagagatctttgcaaacaatccgatctcattttggttgtcggttca
ccgaacagctcaaattccaaccgtttgcgcgaaattggcttagaagaaggtcttcccagc
tatctgatcgccgatggcagcgaaattgatcctgtttggtttgaaggtatcaatacagtc
ggattaacggcaggtgcctctgcgccagaagaattggtgcaaagcgttattaccgccatc
cgcgctctaggacctgtcactgtagaacagcttgacggtgttgaagaaaagattgctttc
cgcttgccgccaaccctgcgccatctcaaagcccgcaatgcggcacataacaatttagac
aacaaaactgctgcttcagaagaggcggacagtctctctaacgatacagaacaggaggct
tga

DBGET integrated database retrieval system