KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0889
Entry
ZMO0889           CDS       T00221                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00052  Galactose metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0889
   00052 Galactose metabolism
    ZMO0889
Enzymes [BR:zmo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     ZMO0889
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-ProteinID: AAV89513
UniProt: Q5NP47
Position
complement(895446..896600)
AA seq 384 aa
MYLCLGLSVPAAVITPTAAYSAASSVSLSSAPFGTTPEGQPVQIYTLKNANGVTVRFISY
GGIIQSIETPDRDGKAGDIVLGFSDLKGYTVDAAKGGLFFGALIGRYANRIANGTYSLGG
KTYHVPVTAAPNALHGGTRGFDKYVWTVRPLPATEHEAGAELTLVSPDNDQGFPGNLTVH
VTYTLNDKNELRLRYQAKTDKPTVLNLTNHSYFNLSGEGSGSIENQILKINADNYTPTDT
TSIPTGEIAPVAGTVLDFRNPMRIGDHLRDNNEQLRYARGYDQNWVINGEYGKQPRLAAQ
IFDPKTGRTMDVLTSQPGMQVYTSNSLDGTYYGKSNKQYRQTDAIAFEAEHFPDSPNHSN
FPTTELKPGQIFDYTTIFRFGTRR
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtatttatgcctcggtttatctgtgccagcggcggttatcacaccgacggctgcctat
agcgctgcgtcttcggtcagtttaagtagtgcgccctttggcaccactcctgaaggccaa
cctgttcagatttacaccttaaaaaacgctaatggcgtaaccgttcgttttatttcttat
ggcggtatcatccaatccatcgaaacgcctgatcgcgatggtaaagccggtgatattgtt
ctcggattttccgatctcaaaggctacaccgtagatgcagcgaaaggcggtctctttttt
ggtgcattgattggtcgatatgccaaccggattgcgaatggcacttacagtctcggcggc
aaaacctatcatgtccccgtaaccgctgcgccgaatgccttacatggcgggacaaggggt
tttgataaatatgtctggacagtccgtcccctgcccgccactgaacatgaagctggtgca
gaattaactttggtcagccccgataatgaccaaggtttcccggggaatttaacggttcat
gtcacctatacattgaatgacaaaaatgaattgcggctgcgttatcaggctaaaacggac
aagccgacggttctcaatctaaccaatcacagctattttaacttaagcggcgaaggctcc
ggttcgattgaaaaccagattttaaaaattaacgccgataactatacgccgacggatacg
acctctattcctactggcgagatagcccctgtagcaggcactgtccttgatttccgtaat
ccaatgcgaattggcgatcatttgcgcgacaacaatgaacagctccgctatgcacgcgga
tatgatcagaattgggttattaacggggaatatggaaaacaacctcgcctcgcagcccaa
attttcgatcctaaaacgggacgaacaatggatgtgctgacatctcaaccggggatgcag
gtttatacctccaattctttggacggtacttattacggcaaaagcaacaaacaatatcgc
caaaccgacgctattgcttttgaagctgaacattttccagattcgcccaatcattccaat
ttcccgacaaccgaactcaaaccgggacagatatttgattatacgacgattttccgcttt
ggaacgcgtcgttag

DBGET integrated database retrieval system