KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0959
Entry
ZMO0959           CDS       T00221                                 

Definition
(GenBank) monofunctional biosynthetic peptidoglycan transglycosylase
  KO
K03814  monofunctional glycosyltransferase [EC:2.4.1.129]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO0959
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:zmo01003]
    ZMO0959
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO0959
Enzymes [BR:zmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ZMO0959
Glycosyltransferases [BR:zmo01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   ZMO0959
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase
   ZMO0959
SSDB
Motif
Pfam: Transgly
Other DBs
NCBI-ProteinID: AAV89583
UniProt: Q5NNX7
Position
complement(974701..975447)
AA seq 248 aa
MGRLFRFFLRIFVYFLLISLLWVGLYRFVRPPITLTMIMNRINGYGLNQTWRPLNQIDPI
MMDAVIASEDSRFCSHHGFDFTAIEQAAKHNASGGHIHGGSTISQQTAKNAFLWQNGGYF
RKLIEAYFTFLIEHFWTKRRIIEVYLNIAETGRGVYGVEAASQYYFHHDASHLSALEAAR
LAAIFPLPKKRSVQMPHGFVRRYGNIIQSRIPLVKRNGLDRCLFTVTTSAISGNSRPQKA
PSPPIGKQ
NT seq 747 nt   +upstreamnt  +downstreamnt
atgggtcggctttttcgcttttttctccggatttttgtctattttcttttaatctcactg
ttatgggttgggctttaccgctttgtcaggccaccgattaccctgactatgatcatgaac
cggataaatggctatggcctcaatcagacatggcggccgcttaatcagatagatcctatc
atgatggatgctgtcatcgcatcggaagatagccgtttttgttctcatcatggttttgat
tttacagcgattgaacaggcggccaaacataacgccagcggcggccatattcatggcggt
tcgaccatcagccagcaaaccgcaaaaaacgcttttctatggcaaaatggcggctatttc
cgaaaattgatcgaggcctattttacctttctgatcgaacatttttggacgaagcggcgg
attatagaggtgtatctcaatatcgccgaaaccggacgcggtgtatacggggtcgaggcg
gcatcacaatattattttcatcatgatgccagccatctttccgcattggaggctgcaaga
ctagccgccatttttcctcttcccaaaaaacgcagcgtccagatgccccatggttttgtg
cgccgttatggcaatatcattcaaagccgaatcccactggttaaaagaaatggattggat
cgctgccttttcacggtcacaacttccgccatatccggtaacagcagaccacagaaagcc
ccgtcgccaccaataggaaagcaataa

DBGET integrated database retrieval system