KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1089
Entry
ZMO1089           CDS       T00221                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00550  Peptidoglycan biosynthesis
zmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO1089
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:zmo01002]
    ZMO1089
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO1089
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ZMO1089
Peptidases and inhibitors [BR:zmo01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ZMO1089
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ZMO1089
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Other DBs
NCBI-ProteinID: AAV89713
UniProt: Q5NNJ7
Position
1099151..1100353
AA seq 400 aa
MPYYIGDSMKPVLFFSASAALCFTAAASYAAAPPFETIAPIAYMKDLSSGAVLYAKDADR
RMPPASMAKMMTVYVAFDLIKKGQLKLDQPITVQPETWKKWHGPSAGSTMFLSPNEQVSA
ANLLHGIVTLSGNDACVVLSEGIAGTEQAFVALMNEKAQKIGLTNSHFGTANGWPDGGAT
YVTAHDLETLAEATIRDFPDLYRQFYGQREFTWGKTMGSGKDITQSNRDPLLGVIDGADG
LKTGHTDEAGYGFTGSAEQRGRRLVMVMAGLPSNAARREQSIAFMNWGFRAWKSKPVVRK
GVRVQTAEVQGGSSSTVGLVAPRDLAVTLPITASDQMKVKVVYQGPIKAPIAQGQHIADL
VVLTSDTPPQITPLVAEKTVEKAGFFGRIGEGIRWLLGRL
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgccttactatatcggtgattcaatgaagccagttctattcttttctgcctctgctgcc
ctctgctttacggcggcggccagctatgcggctgctccaccttttgagacaattgcccct
atcgcctacatgaaagacctttcttcgggcgcggtgctttatgcaaaagatgctgaccgt
cgaatgccacccgcatctatggccaagatgatgactgtctatgttgcctttgatcttatc
aaaaaagggcagcttaaactggatcagccgatcacggttcagccggaaacatggaaaaaa
tggcatggcccttcggcaggttcaacgatgttcctgtcaccgaatgaacaggtaagtgca
gccaatcttttgcatggtattgttacattatccggtaatgatgcctgtgttgttttatcc
gaaggtattgcgggaacagaacaagcctttgttgctttgatgaatgaaaaagcacaaaaa
attggtctcactaattctcattttggcacagccaatggttggccggacggcggcgcaacc
tatgttacggcacatgatcttgagacattagccgaagccactattcgtgatttccctgat
ctttatcgccaattctatggtcaacgtgaatttacatggggtaaaaccatgggatcgggt
aaagatatcacccaatccaatcgcgatccgttattgggcgttattgacggtgctgatggt
ttaaaaactggacataccgatgaagccggatatggctttaccggatccgctgaacaacgg
ggacggcggctagttatggttatggcaggtttgccttccaatgcagcccgtcgggaacag
tcaattgcctttatgaattggggctttagagcttggaaatccaagcctgttgtcaggaag
ggtgttcgtgtccagacagccgaagtgcagggcggtagttcttctactgtcggtttggtt
gcaccacgggatctggcagtgaccttgccgattacggcttctgaccaaatgaaggtcaaa
gtcgtttaccaaggccccatcaaggcaccgattgcccaaggtcagcatattgccgatctg
gttgtcttaacatctgacactccgccacagattacacctttggtggctgaaaaaaccgta
gaaaaagccggattttttgggcgtattggtgaaggtataaggtggcttctggggcgattg
tga

DBGET integrated database retrieval system