KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1128
Entry
ZMO1128           CDS       T00221                                 

Definition
(GenBank) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  KO
K12506  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:2.7.7.60 4.6.1.12]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00900  Terpenoid backbone biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ZMO1128
Enzymes [BR:zmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     ZMO1128
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     ZMO1128
SSDB
Motif
Pfam: YgbB IspD NTP_transf_3 MIF CTP_transf_3
Other DBs
NCBI-ProteinID: AAV89752
UniProt: Q9RNZ1
Position
1144707..1145864
AA seq 385 aa
MKRTDNIALIVAAGQGKRAGEGLPKQYRQIAGKAILAHAIDNLLAHPEIDTVQVVIADGH
QTLYQEAVGDRDLPQPVIGGVFRRDSVINGLKAAHDRGYKRVLIHDAARPFLPKTVIDRL
LDALKSSKAAIPVLPVVDTLVNQEVEAVDRNLFHRVQTPQAFDLETVIAAHQAWTGSDEP
TDDAQVVRAFGKKIALVTGDRLLEKLTYPADFSVAEAQMTEKMISVCGSGFDVHCFEAGD
HIMLGGIKIPHDHGLAGHSDADVALHALTDALLGAIADGDIGTHFPPSDPQWKGANSTQF
LEYAVALAKKAGAIIDHADVTVICEAPKVGPYRPAMRKHIAQILGLPEQRVSIKATTTEK
LGFTGRKEGIAAQAVTSIRLPDILC
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaaaagaacagataatatagcgcttattgtggcggccggtcagggtaaacgtgcaggt
gaaggcctgccgaagcaatatcggcagatcgctggtaaagctattctggcacatgcgatt
gataacctgctcgcccatcccgaaattgatacggtacaagtcgttatcgcggacgggcat
cagacgttatatcaagaggctgttggagaccgagatttaccgcagccagtgatcggtggc
gtttttcggcgcgattctgttattaatggtttgaaggctgcacatgaccgtggttacaaa
cgggttttgattcatgatgccgcccgcccttttctacccaaaacagtgattgatcgccta
ctcgacgccttgaaatcatctaaggcagcaatacccgttttgccagttgttgatactctt
gttaatcaagaagtcgaagccgttgaccgcaatctgttccatcgtgttcaaaccccgcaa
gcctttgatcttgagaccgtgatcgctgcacatcaggcatggacaggcagcgatgaacca
acagatgatgcgcaggttgtccgcgcttttggtaaaaaaattgccttggtaacaggcgat
agactactcgagaaactgacctatcctgctgatttttctgtagccgaggctcaaatgact
gaaaaaatgatttctgtttgcggttcaggtttcgatgttcattgtttcgaagctggtgac
catattatgttgggtggcatcaaaattccgcatgaccatggtcttgccggtcactccgat
gccgatgtcgcactccatgctttgacagatgctttgctgggggcgattgctgatggcgat
atcggaacccattttccgccaagcgacccgcaatggaagggtgcaaattcgacccaattc
cttgaatatgctgttgcgcttgccaagaaagccggagctatcattgaccatgcggatgta
acggttatctgtgaagcgccgaaagtggggccttatcggccagccatgcgtaagcatatt
gcccagattctggggcttcctgaacaaagggtcagcatcaaagcaacgacaactgaaaag
cttggttttacaggccgcaaagaagggatcgctgcccaagcggttaccagtattcgcttg
ccggatattttgtgctaa

DBGET integrated database retrieval system