KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1132
Entry
ZMO1132           CDS       T00221                                 

Definition
(GenBank) lipoic acid synthetase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00785  Lipoic acid metabolism
zmo01100  Metabolic pathways
zmo01240  Biosynthesis of cofactors
Module
zmo_M00881  Lipoic acid biosynthesis, plants and bacteria, octanoyl-ACP => dihydrolipoyl-E2/H
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    ZMO1132
Enzymes [BR:zmo01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     ZMO1132
SSDB
Motif
Pfam: Radical_SAM LIAS_N
Other DBs
NCBI-ProteinID: AAV89756
UniProt: Q9RNY7
Position
complement(1147736..1148707)
AA seq 323 aa
MSKIPAPDEKTSRSDSGSSILRKPDWLRVRSPGGAAFNETHGLIRKLGLATVCEEAACPN
IGECWTKKQATVMILGEVCTRACAFCNVKTGHPDKVNPLEPGHVADVAAEMNLEHIVITS
VDRDDLEDGGASQFVKVIEAVRARTPKTTIEILTPDFRGKPDHALDMIVKARPDVFNHNL
ETVPRLYPTIRPGARYFTSLRLLEKVRERDPSIFTKSGLMLGLGEDRLEVHQVMDDMRQA
DVDFLTLGQYLQPTPRHVRVEEFVTPDSFKAYAATARAKGFSMVASSPLTRSSYYAGADF
ARLKEARQKKLEKIAAKNSGKGA
NT seq 972 nt   +upstreamnt  +downstreamnt
atgagtaaaattcccgcacctgatgaaaaaaccagccgatccgattctggttcctcgatt
ttgcgtaaaccggactggcttcgtgtccgttctcccggtggcgctgcttttaatgaaacc
cacggcttgatacggaaactgggtctggccacggtgtgcgaagaagcagcctgtcccaat
attggagaatgctggacaaaaaaacaggcaaccgtcatgattttgggggaagtctgtacc
cgtgcctgtgctttttgcaatgtaaagacaggccatcccgacaaggtcaatcctttggaa
ccggggcatgttgctgatgtcgctgccgaaatgaatttggagcatattgttatcacatcg
gttgatcgtgatgacctcgaagacggcggcgcttcgcaatttgtcaaagttatcgaagcc
gtcagggcaagaaccccgaaaacgacgattgagattctgaccccagatttccgtggtaag
ccggatcatgcattggatatgatcgtcaaagcccgccccgatgtattcaatcacaatctt
gaaacggtgccccgtctttacccaacgattcgtccgggagcgcgctatttcacttccttg
cgcttgcttgaaaaagtgcgggaacgggacccctctatctttactaaatccggtttaatg
ctgggtttaggcgaagatcgtttggaagtgcatcaggtcatggacgacatgcggcaagcg
gatgtcgacttcttaaccttagggcaatatttgcaacctacgccgcgccatgttcgggta
gaagagtttgttacacctgacagcttcaaggcctatgcggcgacagctagagccaagggt
ttttcaatggtggcatcctctcctttaacgcgttccagctattatgccggtgctgatttt
gcgcgtttaaaagaagcccgccaaaagaagttggaaaaaatagccgccaaaaatagcggg
aagggtgcctaa

DBGET integrated database retrieval system