KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1150
Entry
ZMO1150           CDS       T00221                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00900  Terpenoid backbone biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ZMO1150
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ZMO1150
SSDB
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Sacchrp_dh_NADP DUF4213 Semialdhyde_dh NmrA
Other DBs
NCBI-ProteinID: AAV89774
UniProt: Q9X5F2
Structure
PDB: 
1R0K 1R0L

Position
complement(1168213..1169379)
AA seq 388 aa
MSQPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIA
DPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTV
ALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPF
RTTSLAEMATVTPERAVQHPNWSMGAKISIDSATMMNKGLELIEAYHLFQIPLEKFEILV
HPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAP
DYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPA
TPSSLEDVFAIDNEARIQAAALMESLPA
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgagtcagccaagaacagtcactgttttaggggcgaccggatccattggtcattcaaca
ctggatttaatcgaacggaatttagatcggtatcaggtcatcgctttgaccgccaaccgc
aatgtcaaagatctggccgatgcggcgaaaagaacgaatgccaagcgggcggttatcgct
gacccgtcgctttataatgatctgaaagaggctttggccggaagctctgttgaggcagcc
gcgggtgctgatgccttggtcgaagccgccatgatgggtgccgattggacaatggcagcc
attatcggttgcgccggtctaaaagcgacgcttgcagctattcgcaagggcaaaacggtc
gctttagcgaataaggaatccttagtttcagctggcggattgatgatcgatgccgtgcgg
gaacatggcacgacgcttctccccgtcgattccgagcataacgctattttccaatgcttc
ccgcatcataaccgcgactatgttcgccggattattattacggccagcggaggtcccttc
agaacaacgtctcttgccgaaatggcaacggtcacgccagaacgcgcggttcagcatccc
aactggtcaatgggtgccaagatttctatcgattctgctacaatgatgaataaggggctt
gaattgatagaagcctatcatctcttccagattccattagaaaaatttgaaattttggtt
catcctcagtcagttattcactccatggtggaatatttggatggttctatccttgcccag
atcggtagtcctgatatgagaacaccgatcggtcatactttggcttggccaaagcggatg
gaaacaccagccgaatcgttggattttaccaaattgcgccagatggattttgaagcacca
gattatgaacgttttccggcattaactttggcaatggaatccatcaaatcaggtggggct
cgtcctgctgtaatgaatgccgctaatgaaatagctgtggcggccttccttgataagaaa
atcggttttcttgatatcgctaaaattgtcgagaaaacattagatcattatacacccgca
accccgtcttctttggaagatgtctttgcgatcgacaatgaagcgcggatacaagccgct
gctttaatggagagtttgcccgcgtga

DBGET integrated database retrieval system