KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1152
Entry
ZMO1152           CDS       T00221                                 

Definition
(GenBank) undecaprenyl diphosphate synthase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00550  Peptidoglycan biosynthesis
zmo00900  Terpenoid backbone biosynthesis
zmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO1152
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ZMO1152
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:zmo01006]
    ZMO1152
Enzymes [BR:zmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     ZMO1152
Prenyltransferases [BR:zmo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ZMO1152
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: AAV89776
UniProt: Q9X5F1
Position
complement(1170005..1170751)
AA seq 248 aa
MIAPLANSAVKPHKSASFVPRHVAIIMDGNGRWASARHLPRIAGHKKGADAVKTTVRAAA
EMGIEVLTLYAFSSENWRRPASEVADLMGLLRLCLRQEMHNIKERGICLKVIGDYTRLDQ
DLVALLNQAIEITANNTRLTLVFALNYGAQDELVHVTKRIAEKAKEGQLDPENIDVGTIE
SLLYTHDLPPLDLVIRTSGEKRLSNFLLWQAAYAELLFIDTLWPDFGSETLKAAVEEYAR
RERRYGGL
NT seq 747 nt   +upstreamnt  +downstreamnt
gtgatagccccgctggccaattctgcggtaaaaccgcataagtccgcatcctttgtgcct
cgtcatgttgccatcatcatggatggcaatggacgatgggcttctgcgcgccatttacct
agaattgctgggcacaaaaagggtgccgatgcggtcaaaacaacggtgcgggctgccgca
gagatgggtattgaggttctaaccttatatgctttttcttctgaaaattggcgccgtcct
gctagcgaagtcgctgatcttatgggattattgcgactttgccttcggcaggaaatgcac
aatattaaagagcgtggcatctgccttaaggtgattggcgattatacacgcctcgatcag
gatctggtcgctttactcaatcaagcgattgaaattacagctaataacacaaggctgact
ttagtttttgccttgaattatggcgcacaagacgaattggtgcatgtcactaaacgcatt
gcagagaaggctaaagaagggcagcttgatcccgaaaatattgatgtcgggacaattgaa
tctctgttatatacccatgatttaccaccccttgatctagttatcagaacttctggtgaa
aagcgcttgtccaatttcttattatggcaagccgcttatgcggagttactgtttatagat
accttatggcctgatttcggcagcgaaactctgaaagctgcggtagaagaatatgcacgc
cgggaaaggcgctatggtggcttgtga

DBGET integrated database retrieval system