KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1178
Entry
ZMO1178           CDS       T00221                                 

Definition
(GenBank) Phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00340  Histidine metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ZMO1178
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     ZMO1178
SSDB
Motif
Pfam: PRA-CH
Other DBs
NCBI-ProteinID: AAV89802
UniProt: Q9X3W1
Position
complement(1196712..1197086)
AA seq 124 aa
MQNDQDYGNKLNPAWDEKGLITAVLTDAKTGLLLMVAHMNKESFELSMATKEATFWSRSR
KKIWRKGEESGHVMKIQEIRIDCDQDTLWLKVIPMGPACHTGAQSCFYRLVEDGHLVTIP
KDKI
NT seq 375 nt   +upstreamnt  +downstreamnt
atgcagaacgatcaggattatggaaataaattaaatcctgcatgggatgaaaagggttta
attacagccgttttgaccgatgcaaagacaggccttttattgatggtcgcccatatgaac
aaagaatcctttgaactgagtatggcaaccaaagaggctaccttctggtcacgctctcgc
aaaaagatctggcgtaagggagaagaatccggtcatgttatgaaaatacaggaaattcgt
attgattgtgatcaggataccctttggttgaaagttatccctatgggaccggcctgccat
acaggtgcacaaagttgtttttatcggttagtcgaagatggacatctggtaacaataccc
aaagataaaatataa

DBGET integrated database retrieval system