KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1182
Entry
ZMO1182           CDS       T00221                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00900  Terpenoid backbone biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ZMO1182
Enzymes [BR:zmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ZMO1182
SSDB
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Other DBs
NCBI-ProteinID: AAV89806
UniProt: Q9X3W5
Position
complement(1201042..1201890)
AA seq 282 aa
MPKLTEIAYAKINLALHVRGKMPNGYHALETIFAFAKDGDILQAEANDTEDNLTITGPFS
EGLEANKDNLVLRAVTALRQACPNKIPAGFSIILDKRLPVAAGIGGGSADAAAMLRMIGQ
HYQIPHELILSLANSLGADVPACVDSCLVRGEGVGEKLTQIGDRSLEEKPLLLVNPRVSC
STPMIFKNWDGVDRGALDSDGSILGAARSGRNDLEPPARKILPIIGEVVEWLQQQKGVSF
SRMSGSGATCFALFDEIEDRDTAYKKLNIDHPEWWALSSLLR
NT seq 849 nt   +upstreamnt  +downstreamnt
gtgcccaagctaacagaaatagcctatgccaaaatcaatctggcgcttcatgtgcgggga
aaaatgccgaatggttatcacgcattagagactatttttgcttttgctaaagatggcgat
attctccaagccgaagcgaatgatacagaagataatttaacgattacgggtcctttttca
gaaggattagaagccaataaagataatcttgttttaagggcagtcaccgctttacggcag
gcctgtcctaataaaatacccgctggattttctattattcttgataaaagattgcccgtt
gcagctggtattggcggcggatcagctgatgctgcggctatgctgcggatgatcgggcaa
cattatcaaattcctcatgaactgattttatcccttgctaatagtctgggtgcagatgtg
cctgcttgtgttgattcctgtttagtaagaggggaaggcgttggcgaaaaactgacacag
attggtgaccggtctttagaagaaaaacccctattattggtaaatcctagagtatcctgt
tcgaccccaatgatttttaaaaactgggatggtgttgatcgaggcgcattggatagcgat
gggtctatattaggtgccgcccgatctgggcgtaatgatttggagccaccggcaaggaag
atattgccgattattggagaagtcgttgagtggttacaacaacaaaaaggggtcagtttt
tctcggatgtcaggatcgggagcaacttgtttcgcacttttcgatgaaattgaagaccgg
gatacggcctacaaaaaattgaatattgaccatccagagtggtgggctttgtcgtcatta
ttacgatga

DBGET integrated database retrieval system