KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1212
Entry
ZMO1212           CDS       T00221                                 

Definition
(GenBank) Glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00030  Pentose phosphate pathway
zmo00500  Starch and sucrose metabolism
zmo00520  Amino sugar and nucleotide sugar metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
Module
zmo_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO1212
   00030 Pentose phosphate pathway
    ZMO1212
   00500 Starch and sucrose metabolism
    ZMO1212
   00520 Amino sugar and nucleotide sugar metabolism
    ZMO1212
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zmo04147]
    ZMO1212
Enzymes [BR:zmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     ZMO1212
Exosome [BR:zmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ZMO1212
  Exosomal proteins of other body fluids (saliva and urine)
   ZMO1212
  Exosomal proteins of colorectal cancer cells
   ZMO1212
SSDB
Motif
Pfam: PGI HflX_C
Other DBs
NCBI-ProteinID: AAV89836
UniProt: P28718
Position
complement(1235732..1237255)
AA seq 507 aa
MARIANKAAIDAAWKQVSACSEKTLKQLFEEDSNRLSGLVVETAKLRFDFSKNHLDSQKL
TAFKKLLEACDFDARRKALFAGEKINITEDRAVEHMAERGQGAPASVARAKEYHARMRTL
IEAIDAGAFGEVKHLLHIGIGGSALGPKLLIDALTRESGRYDVAVVSNVDGQALEEVFKK
FNPHKTLIAVASKTFTTAETMLNAESAMEWMKKHGVEDPQGRMIALTANPAKASEMGIDD
TRILPFAESIGGRYSLWSSIGFPAALALGWEGFQQLLEGGAAMDRHFLEAAPEKNAPILA
AFADQYYSAVRGAQTHGIFAYDERLQLLPFYLQQLEMESNGKRVDLDGNLIDHPSAFITW
GGVGTDAQHAVFQLLHQGTRLVPIEFIAAIKADDTLNPVHHKTLLTNAFAQGAALMSGRD
NKDPARSYPGDRPSTTILMEELRPAQLGALIAFYEHRTFTNGVLLGINSFDQFGVELGKE
MAHAIADHPENSDFDPSTKALIAAALK
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcaagaatcgcaaataaagcagccatagatgctgcatggaaacaagtttccgcttgc
tcggaaaaaactttaaaacagctttttgaagaagacagtaaccgtctttcaggtctggtt
gtggagacagcaaaactccgttttgatttttccaaaaatcaccttgatagccagaagctg
actgccttcaaaaagctgttagaggcttgtgactttgatgccagaagaaaagcgctcttt
gccggtgaaaaaatcaatataacagaagaccgtgcagttgagcatatggccgaacgtgga
cagggtgcccctgccagcgtcgcccgtgccaaagaatatcatgcccgtatgcgtacgctg
atcgaagctatcgatgcgggtgccttcggtgaagtcaaacatttattgcatatcggcatt
ggcggttctgctctcggccccaaattgctgattgatgccctgactcgtgaatctggccgc
tatgatgttgcggttgtttccaatgttgacggtcaggctctggaagaagtcttcaaaaaa
ttcaatccgcataaaaccctgattgcggttgcttccaagaccttcactaccgcagaaacc
atgctgaacgcagaatccgcgatggaatggatgaagaagcatggcgtcgaagatcctcag
ggtcgcatgattgcccttaccgccaatccggcgaaggcttctgaaatgggtattgatgat
acccgcatcctgcctttcgcagaaagcatcggcggccgctattctctgtggtcttccatc
ggttttccggcggcgctggctcttggctgggaaggcttccagcagcttctcgaaggtggc
gcggctatggatcgccatttcctcgaagccgctcctgaaaagaacgcgcctattctggct
gctttcgctgaccagtattacagtgccgtccgcggtgcgcagactcatggcattttcgcc
tatgacgaacgcctgcaacttttgcctttctatctccagcagttggaaatggaatccaat
ggtaaacgcgttgacctcgatggcaatctgattgaccatcccagcgctttcatcacttgg
ggcggtgtcggtaccgatgcccaacatgcggtattccagcttttgcatcagggaacccgt
ctggttccgatcgaatttattgctgctatcaaagcagacgatactttaaatccggtgcat
cataaaaccttgctgaccaacgccttcgcacagggtgccgccctgatgagtggccgcgac
aacaaggatccggcacgttcttatccgggtgaccgtccgtcaacgacgatcctgatggaa
gaattgcgtccggctcagttgggtgctttgattgccttctacgaacatcgcactttcacg
aatggtgttcttttgggcatcaacagctttgaccagttcggtgttgaactcggaaaagaa
atggctcacgccattgccgatcatcctgaaaattccgatttcgacccgtcaaccaaggct
ttgattgcggctgctttgaaataa

DBGET integrated database retrieval system