KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1234
Entry
ZMO1234           CDS       T00221                                 

Definition
(GenBank) deoxyxylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00730  Thiamine metabolism
zmo00900  Terpenoid backbone biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ZMO1234
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ZMO1234
Enzymes [BR:zmo01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     ZMO1234
SSDB
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C Transketolase_N DUF1194
Other DBs
NCBI-ProteinID: AAV89858
UniProt: Q5NN52
Position
complement(1256510..1258459)
AA seq 649 aa
MFPNDKTPLLDKIKTPAELRQLDRNSLRQLADELRKETISAVGVTGGHLGSGLGVIELTV
ALHYVFNTPKDALVWDVGHQTYPHKILTGRRDRIRTLRQRDGLSGFTQRAESEYDAFGAA
HSSTSISAALGFAMASKLSDSDDKAVAIIGDGSMTAGMAYEAMNNAKAAGKRLIVILNDN
EMSISPPVGALSSYLSRLISSRPFMNLRDIMRGVVNRMPKGLATAARKADEYARGMATGG
TFFEELGFYYVGPVDGHNLDQLIPVLENVRDAKDGPILVHVVTRKGQGYAPAEAAKDKYH
AVQRLDVVSGKQAKAPPGPPSYTSVFSEQLIKEAKQDDKIVTITAAMPTGTGLDRFQQYF
PERMFDVGIAEQHAVTFAAGLAAAGYKPFCCLYSTFLQRGYDQLVHDVAIQNLPVRFAVD
RAGLVGADGATHAGSFDLAFMVNLPNMVVMAPSDERELANMVHSMAHYDQGPISVRYPRG
NGVGVSLEGEKEILPIGKGRLIRRGKKVAILSLGTRLEESLKAADRLDAQGLSTSVADMR
FAKPLDEALTRQLLKSHQVIITIEEGALGGFATQVLTMASDEGLMDDGLKIRTLRLPDRF
QPQDKQERQYAEAGLDADGIVAAVISALHRNSKPVEVVEMANMGSIARA
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgtttccgaatgacaagacgccgctgttagacaagatcaagacaccggcagaattgcgt
caattagatcgcaacagcctccggcaattggcggatgaattacggaaagagaccatctcg
gcagtgggtgtgaccggcggacatctcggttccggtctgggggttatcgaattaacggta
gcccttcactatgttttcaacacgcccaaagacgctttagtctgggatgttgggcatcaa
acctatcctcacaagattttaacaggtcgccgcgatcgtattcggacattgcggcaacgt
gacggcttatcgggctttacgcagcgcgcggagagcgaatatgacgcttttggagccgcg
catagttcgacttctatttctgcggcgctcggctttgcgatggccagcaaattatccgac
agcgacgacaaagcggttgcgattatcggtgatggctcgatgacggcaggcatggcttat
gaagccatgaataacgccaaggcggcgggtaagcgcctgattgtcattttgaatgacaat
gaaatgtcgatttcaccgccggtgggtgccttatcgtcttatttgagccgcctgatttcc
tcacggcctttcatgaatttgcgcgatatcatgcgcggcgttgttaaccggatgccaaaa
ggcttggcaacggctgcccgcaaggctgatgaatatgcgcgtggtatggcaaccggtggc
accttctttgaagagctgggcttttactatgttggccccgtggatggtcataatttagat
cagctcattccagttttagaaaatgtccgcgatgccaaggacggccccattttggtgcat
gtcgtcactcgcaaaggccaaggctatgctccggctgaagcggccaaggacaaatatcac
gccgtgcagcgcttggatgtggtttccggtaagcaggcgaaagcgcccccgggacctccc
agctatacctctgttttttcggaacagctgatcaaggaagctaagcaagacgataagatt
gtgaccattacggcagctatgccgactggcaccggtcttgatcgttttcagcaatatttt
cctgaaagaatgtttgatgtcggtattgccgaacaacatgccgtaacctttgcggctggt
ttggcggctgccggttacaagcctttctgttgtctctattcgaccttcttgcagcgcggc
tatgaccagttggtgcatgatgtcgctatccagaatttgccggtgcgcttcgccgtcgat
cgtgcgggtcttgtcggtgccgatggggcaacccatgcgggtagcttcgacctcgccttt
atggttaatctcccgaatatggtcgtgatggcgccttccgatgaacgggaattggccaat
atggtgcatagcatggcgcattatgaccaaggcccgatctcggtgcgttatccgcgtggt
aatggtgtgggtgtctccttggaaggtgaaaaggaaattctgcctatcgggaaaggtcgc
ctgatccgtcgcggtaaaaaggttgctatcctatctctcggcactcgattggaagaatcc
ttgaaggctgctgatcggcttgatgctcaaggtttgtcgacatcggttgctgatatgcgt
tttgctaagcccttggatgaagcgctgacccgccaacttttgaaaagccatcaggtcatt
attaccattgaagaaggcgctttgggtggttttgcaacccaagtcctgacgatggcttcg
gatgaaggcctgatggatgacggattgaaaatccgcaccctgcgtctgccggatcggttc
cagccgcaagacaagcaagaacggcaatatgccgaagccggtcttgatgctgatggcatc
gttgctgcggttatctccgcattgcatcgtaattctaaacccgtggaagtcgtcgaaatg
gcgaatatgggtagcatcgctcgcgcttaa

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1598
Entry
ZMO1598           CDS       T00221                                 

Definition
(GenBank) deoxyxylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00730  Thiamine metabolism
zmo00900  Terpenoid backbone biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ZMO1598
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ZMO1598
Enzymes [BR:zmo01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     ZMO1598
SSDB
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C Transketolase_N DUF1194 Tir_receptor_C
Other DBs
NCBI-ProteinID: AAV90222
UniProt: Q5NM38
Position
1636185..1638167
AA seq 660 aa
MPNAEFDFRPMFPNKKTPLLDKIKTPAELRQLDRNSLRQLADELRKETISAVGVTGGHLG
SGLGVIELTVALHYVFNTPKDALVWDVGHQTYPHKILTGRRDRIRTLRQRDGLSGFTQRA
ESEYDAFGAAHSSTSISAALGFAMASKLSDSDDKAVAIIGDGSMTAGMAYEAMNNAKAAG
KRLIVILNDNEMSISPPVGALSSYLSRLISSRPFMNLRDIMRGVVNRMPKGLATAARKAD
EYARGMATGGTFFEELGFYYVGPVDGHNLDQLIPVLENVRDAKDGPILVHVVTRKGQGYA
PAEAAKDKYHAVQRLDVVSGKQAKAPPGPPSYTSVFSEQLIKEAKQDDKIVTITAAMPTG
TGLDRFQQYFPERMFDVGIAEQHAVTFAAGLAAAGYKPFCCLYSTFLQRGYDQLVHDVAI
QNLPVRFAVDRAGLVGADGATHAGSFDLAFMVNLPNMVVMAPSDERELANMVHSMAHYDQ
GPISVRYPRGNGVGVSLEGEKEILPIGKGRLIRRGKKVAILSLGTRLEESLKAADRLDAQ
GLSTSVADMRFAKPLDEALTRQLLKSHQVIITIEEGALGGFATQVLTMASDEGLMDDGLK
IRTLRLPDRFQPQDKQERQYAEAGLDADGIVAAVTAALQRNSKPVEVVELTTKVTEDMTL
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgcctaatgcagagtttgatttcaggcctatgtttccgaataaaaagacgccgttgtta
gacaagatcaagacaccggcagaattgcgtcaattagatcgcaacagcctccggcaattg
gcggatgaattacggaaagagaccatctcggcagtgggtgtgaccggcggacatctcggt
tccggtctgggggttatcgaattaacggtagctcttcattatgttttcaacacgcccaaa
gacgctttggtctgggatgttgggcatcaaacctatcctcacaagattttaacaggtcgc
cgtgatcgtattcggacattgcggcaacgtgacggcttatcgggctttacgcagcgcgcg
gagagcgaatatgacgcttttggagcagcgcatagttcgacttctatttctgcggcgctc
ggctttgcgatggccagcaaattatccgacagcgacgacaaagcggttgcgattatcggt
gatggctcgatgacggcaggcatggcttatgaagccatgaataacgccaaggcggcgggt
aagcgcctgattgtcattttgaatgacaatgaaatgtcgatttcaccgccggtgggtgcc
ttatcgtcttatttgagccgcctgatttcctcacggcctttcatgaatttgcgcgatatc
atgcgcggtgttgtcaaccggatgccaaaaggcttggcaacggctgcccgcaaggctgat
gaatatgcgcgtggtatggcaaccggtggcaccttctttgaagagctgggcttttactat
gttggccccgtagatggtcataatttagatcagctcattccggttttggaaaatgtccgc
gatgccaaggacggccccattttggtgcatgtcgtcacccgcaaaggccaaggctatgct
ccggctgaagcggccaaggacaaatatcacgccgtgcagcgcttggatgtggtttccggc
aagcaggcgaaagcgcccccagggcctcccagctatacctctgttttctcggaacagctg
atcaaggaagctaagcaagacgataagattgtgaccattacggcagctatgccgactggc
accggtcttgatcgcttccagcaatattttcctgaaagaatgtttgatgtcggtattgcc
gaacaacatgccgtaacctttgcggctggtttggcggctgccggttacaagcctttctgt
tgtctctattcgaccttcttgcagcgcggctatgaccagttagtgcatgatgtcgctatc
cagaatttgccggtgcgcttcgccgtcgatcgtgcgggtcttgtcggtgccgatggggca
acccatgcgggtagcttcgacctcgcctttatggttaatctaccgaatatggtcgtgatg
gcgccttccgatgaacgggaattggccaatatggtgcatagcatggcgcattatgaccaa
ggcccgatctcggtgcgttatccgcgtggtaatggtgtgggtgtctccttggaaggcgaa
aaggaaattctgcctatcgggaaaggtcgcctgatccgtcgcggtaaaaaggttgctatc
ctatctctcggcactcgattggaagaatccttgaaggctgctgatcggcttgatgctcaa
ggtttgtcgacatcggttgctgatatgcgttttgctaagcccttggatgaagcgctgacc
cgccaacttctaaaaagccatcaggtcattattaccattgaagaaggcgctttgggtggt
tttgcaacccaagtcctgacgatggcttcggatgaaggcctgatggatgacggattgaaa
atccgcaccctgcgtctgccggatcggttccagccgcaagacaagcaagaacggcaatat
gccgaagctggtcttgatgctgatggcatcgttgctgccgtaacggctgcattacaacgg
aactcaaagcctgtcgaagtcgttgagctgactacaaaagtaacagaagatatgacttta
tga

DBGET integrated database retrieval system